SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA06361 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA06361
Domain Number 1 Region: 41-192
Classification Level Classification E-value
Superfamily PH domain-like 4.61e-32
Family Third domain of FERM 0.0018
Further Details:      
 
Weak hits

Sequence:  CJA06361
Domain Number - Region: 20-43
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0293
Family Second domain of FERM 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA06361   Protein: JA19853   Gene: WBGene00125565
Sequence length 397
Comment JA19853 WBGene00125565 locus:Cjp-frm-2 status:Predicted
Sequence
MSWMLRSLSARFSRNRQPPRNPGQTPAQAELNYLNKARWIEMYGVDMHTVEGRDGNTYRL
GLTPQGMLVFDGPQKIGLFLWERLQKLDFKNKKITLVVEEDADQSNNGQIQLHTFVFHLT
SEKAAKHFWKCAIEQHAFFRLKSRPIHSNKKIQFFRLGSTFKYRGRTEYETIHKERARLS
RRQSCSFERRPSQRYGPRQSHMTNSQVREAKRAEIRQQVEQQQQQQRTHVDPLPSVPNLP
IPPSPDAKRNQIINNNNPFIQHAPSTLSSSSSSAGSQLQSQSQSHVTKITVGTLGGTPSE
SHLPHPSSHIPRPVVSSSSSFSHPPPLPAHQSSSSSSSKIPRMSSASEPRKLSQPQPAAR
LHTFEDSSRKYSHTGCVPAPSRIVPPMQHQRRIVTDF
Download sequence
Identical sequences 281687.CJA06361 CJA06361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]