SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA06460 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA06460
Domain Number 1 Region: 32-109
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000758
Family First domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 114-160
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000055
Family Second domain of FERM 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA06460   Protein: JA03266   Gene: WBGene00125664
Sequence length 201
Comment JA03266 WBGene00125664 status:Predicted
Sequence
MGKDREPVDQQHHPPPATSPAPSQHPRDPKMQAARVRLPYGVYKEFEVNRGSEGEALFRQ
VTSGLSIEESEYFSLCFYDNEEGIRYWLYNDKQLKNLPWEFSFEVKFYPTTIVDHARYYV
FLQLCPDILTGRLPAAADTHALLGSFVGQIEFGDAPAQVNDDYEKFIVGARLVPTEHSNA
EVSRTERTDGFGGGDFVPGPL
Download sequence
Identical sequences A0A2H2I3U1
CJA06460 281687.CJA06460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]