SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA06613 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA06613
Domain Number 1 Region: 1-269
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3e-81
Family Reverse transcriptase 0.00014
Further Details:      
 
Domain Number 2 Region: 416-569
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.44e-43
Family Retroviral integrase, catalytic domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA06613   Protein: JA19686   Gene: WBGene00125817
Sequence length 621
Comment JA19686 WBGene00125817 status:Predicted
Sequence
RCMNELIKDVQARIFVYIDDLIITSRSAAEHLQDIDEVLGRIEDIGMKLKAEKSKFAMKE
IRFLGFLVSKDGIRADPEKTKAVAEFPRPKTVKDVRAFLGMASFYRRFVENFSKIAIPLC
ELTKKDVAFNWTMEREKAFQQLKDALISDQVLAAPKLGKPFVIEVDSSGLGVGAVLSQYQ
NKEEKDLKVIAYASRTYNIHERNYVAIELEALGLVFAVHNFRPYIDGARTTVITDHSPLK
ALLHRKDLTGRLARFQIAIQGYDIHIVYRPGKQNTVCDTLSRYHPEMVNTLNRLLNIDFA
KIREEQTNDERILESRKFIRSHLVQNDIVFTKGEKDEWVIFLPHNSAYGQELAKMIHESI
FEGAHLGRDKTESRVRSIACWKGMTRAIQKVVEQCQVCQKTKDPIKNRIHAPLGKFETPS
SPFERVHADYIGPLPETTQGNIYIAVFVDAFSKFIIAEPARNQTAESLCNIFKDRVVSRF
GPPKQLVTDRGTNFTSKKFKEVLETLNIDHSMSAAYHHEANGQVERANQTIEQMLRQCKD
DEEWDTELQTLLHAYNTAQNATTGVSPHMVMHGQDARRTTYTRKPGENTYRPQESMQTTH
RRDQPNGEQPTPVTSSLTKKX
Download sequence
Identical sequences CJA06613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]