SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA06888 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA06888
Domain Number 1 Region: 25-262
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 8.18e-74
Family Reverse transcriptase 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA06888   Protein: JA34604   Gene: WBGene00126092
Sequence length 266
Comment JA34604 WBGene00126092 status:Predicted
Sequence
EDPKFRITLDKAVCTETQKQVLRNLFSEFHDVFSKNAYDLGSSKTDPVHIYTSTEIPVRG
RPYRVPVKYQAELQKHINGLLLSERITESNTPWISPIVLVPKKNGSLRVCLDFRKLNEVT
VPDNFPLPRIDAIVEKVGGSKYFSSLDMANGYLQLRLDEESSYKCGFTTEDKVYAYTHLP
FGLKSAASYFQRALRSVLAGLEKDVLVYIDDVLVYSKTFEAHVATLRKVLTRFRAYNLKA
SPAKCEFVKKSITFLGHETPRDGPIG
Download sequence
Identical sequences CJA06888 281687.CJA06888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]