SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA07018 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA07018
Domain Number 1 Region: 1314-1748
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.78e-131
Family Reverse transcriptase 0.0000355
Further Details:      
 
Domain Number 2 Region: 1917-2070
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.66e-39
Family Retroviral integrase, catalytic domain 0.0074
Further Details:      
 
Domain Number 3 Region: 299-343
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000000157
Family Retrovirus zinc finger-like domains 0.00087
Further Details:      
 
Domain Number 4 Region: 1035-1136
Classification Level Classification E-value
Superfamily Acid proteases 0.00000000146
Family Retroviral protease (retropepsin) 0.045
Further Details:      
 
Domain Number 5 Region: 677-772
Classification Level Classification E-value
Superfamily Viral glycoprotein ectodomain-like 0.0000126
Family Glycoprotein B-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA07018   Protein: JA20382   Gene: WBGene00126222
Sequence length 2193
Comment JA20382 WBGene00126222 status:Predicted
Sequence
MSKKIDQQQQNTERDLRHKRRTAQLEANRIGRQLAEVEEQYRREQLARWEPGNDVLPAVE
QENRPLNEELNRNEEVQRQARMVDEPLQPNLRASRPSLRDAPRYDGMGSFATYVRNLNDF
LTAYQHTEEDAKRMMPLLLTGSARDALDRIPKDVREGDWRQLVTRLMEEVHPRDRQLVAQ
TEMNGLRQQSLSAEVFLRKVREIADVAWPGESNRTVREAIVLANFVNGLKDEVRVQVHRS
AVKNVEEALCVAKREESLMRIGGGDALVEAINHLKIATNELLLQKAEVNYIRTAQPPPQS
RQKNIKCFNCGKPGHYKRDCRSSKPERCHECGGHGHLAEECATARKQRRRHAEHINATFE
PEAIRARGGTTLGGIVRNMALIATLFALILPAEAWTTIRAIDLVDCSVPNGVALINPPNK
VDCENVAANNVRKGSVLMNVRNLTLTEITAFKCRIEVFSQCTSSILSNFYRSETEYHWPG
NGISTDSCKEARRIILEKGVLSQLGNGKLVSSLSNSVRNCTLDDEFCQSSSSTIVWRKTA
NRPRCDFITVGNFSASIGDKMLILDKQESAFPLDEKFSPKEVEECFPGEVYSSRGLTFFT
FQEAKEAETVKSTILTSTAKPTTKRPETAEGLRQPPPHPPTRKKRSSRNGTEAEEQPGTD
SVGSLAQVGYMKASYDTAEGNRMNFTAEMVNNKLTYLAKKIEERDKDNFNQLINSICHVR
NRQMGVWRMMLQFDPTAAMRILLNRNDVTAMFKGKDVVQVTQCSKVTVTQIEQNRKSGSA
CTTRTAAKTTDNRIVYLEPGQTEVFHNTGVMECDEVSNYVWQDHDGSFKEADKILNVTNI
DDQGLPNFESRQLIFSSGDLYAGIKESSFPLMLAMSYGASIRSLEQLQEQQERRSTVGNI
GTTNNGMEKLKGPGSQMFQSTVDAVKSATSFFTGFYLYLTIGIGIGLIVLIIIGIIMVKV
FFFKKTLQALINEVEVASNSDVEESELVQINALHEDEEDIMEEIAPPVRAKAALPPIFYF
IPILLHVVCATTDASPADMPYVRISIDDKALVALWDSGATISYVTMSTFLHLGAKLNKNG
HRIARTANGSQFAFHGSFTTTLRIGPVLRDHQFLVADDGCCPGNALLGTDLMKALDAEGI
RTTVRLAKGVLEIGETEIPLVGKTDRIFECTNAVMEILSSENFIINPGEVKNLKITNRED
VGSDEAVVLESKDGGKLLYSKTIFHPIDSRQTEVRVQNMTNKPIELEERDIIGEGKIVKL
TDLPKPSPPDVPAEANWEENLFENLFEKEPYMSKLDLSGAAIDKKQKNLLEETIRNYKDA
FYNEDGSIGRFTGGIEHTITTTQDINTLKPRKCHIPPGNIAEVETQVKDMLAPGVIEPST
SFFTSPIVLVRKKDGTFRFTTDFRMLNGITQKQNYILPKVEDIINLAAGGQFYTNLDLVQ
GFFQIPLRVEDRHLTAFSTPFGTYQYRRMPMGVCGAPHTFQMAVRKIEQCVKARLFCYLD
DLLIVSPSFEQHLEDINEVLQAISQMGLKIKMGKCKFAQKEVTFLGLLVGREGVKPNPEK
VRAIAEFPVPKSVTGVRGFLGMANYFRKFVRGFAEMAAPLNDLTKKDVAFSWTSKHQTSF
DEIKMALCRAPVLAAAVSGKPFVMETDASSIAVGAMLLQEGDDKELHPIAFASRKLTVTE
RKYVAIEAEALGLAFGVKAFRTYILGSKITAIVDHRPLTSLLHRRDLIGRLAKYQIVLQE
LSLEIVYRPGRLNSVCDALSRYIGNEKKEARGSSEKEDVVNTVSGGHITVEEMKEIQSTS
DFIMGLAEKLQDGNQNLSMQYFIKKGLVYKKCNNGKDAILLPNDKEVIEKITKFYHETAH
LGAHLGHEKTEAIIRNRFFWKNMGQSIRNFTNRCVQCQKRKIYPKDETREPLENLETLTR
PWERLHLDVCGPFPITEKGNRYILTAKDDFSKFLLAIPIQTQKTAEIANAILHDIILKFG
TPRSVVTDNGSNFKSELFESVLTTLRITHRVTVPYHKEGNGTIERVHRTLEESLASFVNS
TCTDWDEKLPFIVFGINSAPHSLTKISPHQAIFGRELQTPEDVEIGKPISSYLDPEDHLE
KLRAHLADLHLGISERIAKQERKSKDQYEKTHRVKERIVEVGDSVLVKRQEPVNKLAPRL
NGPFKVVEVSKYNVKYLDGKKIKLGHKNDIRMV
Download sequence
Identical sequences 281687.CJA07018 CJA07018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]