SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA07271 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CJA07271
Domain Number - Region: 18-43
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00105
Family Second domain of FERM 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA07271   Protein: JA38624   Gene: WBGene00126475
Sequence length 114
Comment JA38624 WBGene00126475 status:Predicted
Sequence
MNSRLTFAPDLRLSEFLKIDNHARYYVFFQLRRDILTGRQPPPTLMSSSVLLSLKSSLAM
RPHKSMTKVSRTERTDGFGGGDFVPGPLATVNLQEDEGPRHSEKNSRQLRRTLT
Download sequence
Identical sequences CJA07271 281687.CJA07271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]