SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA07452 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA07452
Domain Number 1 Region: 201-337
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-42
Family Third domain of FERM 0.00000097
Further Details:      
 
Domain Number 2 Region: 91-200
Classification Level Classification E-value
Superfamily Second domain of FERM 9.42e-37
Family Second domain of FERM 0.00000655
Further Details:      
 
Domain Number 3 Region: 481-563
Classification Level Classification E-value
Superfamily Moesin tail domain 3.27e-27
Family Moesin tail domain 0.0002
Further Details:      
 
Domain Number 4 Region: 7-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.93e-25
Family First domain of FERM 0.0000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA07452   Protein: JA19063   Gene: WBGene00126656
Sequence length 563
Comment JA19063 WBGene00126656 locus:Cjp-erm-1 status:Partially_confirmed
Sequence
MVAAGDINVRVTSMDSELEFAIQSSTTGKQLFDQVVKTIGLREIWYFGLQYTDNKGFPTW
LKLNKKVMSQDVRKDPTLVFKFRAKFYPEDVAEEIIQDVTMRLFYLQVKDGILSDEIYCP
PETSVLLASYAMQAKYGDYVPETHVAGCLTADRLLPQRVLGQFKLNSEEWERRIMTWWAD
HRGTTREQAMLEYLKIAQDLEMYGVNYFEIRNKKGTDLYLGVDALGLNIYDKADRLSPKV
GFPWSEIRNISFNDKKFVIKPIDKKAHDFVFYAPRLRINKRILALCMGNHELYMRRRKPD
TIEVQQMKQQAREERALKIAEQEKLTREMSAREEAEARQRDAEKRIAQMQEDMERARLEL
AEAHNTIHSLEAQLKQLQLAKQALEQKEYELRELTAQLQSEKAMSDDERRRLRDQVDARE
REVYTMRQEVERQTTVTRQLQTQITTQQHVQHSYSSHVTNGHARDESATDDEDNGATELT
NDADQNVPQHELDRVTAAEKNIQIKNKLDMLTRELDSVKDQNAITDYDVLHMENKKAGRD
KYKTLRQIRGGNTKRRIDQYENM
Download sequence
Identical sequences CJA07452 281687.CJA07452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]