SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA07934 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA07934
Domain Number 1 Region: 670-793
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.33e-32
Family Reverse transcriptase 0.0022
Further Details:      
 
Domain Number 2 Region: 382-412
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000166
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 
Domain Number 3 Region: 431-533
Classification Level Classification E-value
Superfamily Acid proteases 0.00000413
Family Retroviral protease (retropepsin) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA07934   Protein: JA30330   Gene: WBGene00127138
Sequence length 794
Comment JA30330 WBGene00127138 status:Predicted
Sequence
MNSVFLDGRPSTENERLQERIRKCESEKLAAEKRLRKAQRAFEAEKRTAEGLKANLQHAA
GEFEICRVQDEKHQIIQKRSRRASGSPTDSRRSSLRSRTREQSQGTLEEEESGDDWRRKV
NGWDIQREKAVHSEKTENRRIKNAGSLSGSERSEMKGMVECMSRMMKSSALPEPRGFDGS
GDFGELKRTFLLKYGQVTSGDDELVAILEDKFLKGSAKALFKSLARRYERPIKSLFDEFE
MKLRKRQGDSKAEALNEFDGLKREKSKKMWEYLTEVEKWSKLAYPEVSEETLSQMRTTKL
MKAVRDDDTLHRMLIMKRLEIPLRHQYENLKDIVLQQENEKRRAYGQKKRENAVVRGKPW
MDRADERRNNPHKEDRKDEFEPNQRERNRDIANTKCFRCGAVGHMARQCTSRPVQNVDAE
KEAVGAEMVEMVDILGQKRRIVIDSGAVVSVMSTGAWERLKRKCPEWEEKVEVLAKPNFS
LVDASKAKMPVREQIKVEIGIRGRKAVVVFQLVENELDIFLLGTNSFETVGVELKWKAER
AVARAARKLRVPPQSCAQIAVRTEADLGDVILLESEKEWVPTSLCSKNEDGNVTILVSNW
KDQPLLIKKNQVIGVGSRDWAMCKPEVAQAAINMMELDRKIPLEGARKKEAVLKILKENG
EIPEGKIERIVAEFSDIFAIEDNELTQTNMTECAIELEKEEPIRQKCRPVPLALQEKVRG
MLKDMEERCVIKKCRSPWASPVVLVKKKDGSIRMCVDYRKLNAVIKLNAHPLPHIESTLQ
ALRGKKWFTTLDLM
Download sequence
Identical sequences 281687.CJA07934 CJA07934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]