SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA07984 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA07984
Domain Number 1 Region: 1051-1480
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.67e-27
Family Reverse transcriptase 0.019
Further Details:      
 
Domain Number 2 Region: 1810-1976
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.76e-18
Family Retroviral integrase, catalytic domain 0.02
Further Details:      
 
Domain Number 3 Region: 763-809
Classification Level Classification E-value
Superfamily Acid proteases 0.0000493
Family Retroviral protease (retropepsin) 0.022
Further Details:      
 
Weak hits

Sequence:  CJA07984
Domain Number - Region: 229-285
Classification Level Classification E-value
Superfamily BAG domain 0.0667
Family BAG domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA07984   Protein: JA34812   Gene: WBGene00127188
Sequence length 2453
Comment JA34812 WBGene00127188 status:Predicted
Sequence
MPLAFTGRRNSGFIQFVYTAQAAFKETLEMADQLVVNYKKKITTKVNRAKNLLTSVESAV
VACKGQEEIDIVAERHVDDIKEKIKSLDEMMNEVDKFLGEHQQLSSDQEFFKANRNLLEK
HYEMQGPAKLKKELDDLINKLQNRQRSTRGILSEQNMAGESRSTTDGKNSHQHRGETGSQ
HNPTQSPAVDEATNDDSDRRKSVQFIKTQSPSTSNSETKSENSIDIFREEMLQRIQQIER
QYDSVEKKYDSISSQVVQVRDDIRKERETTQDVLVKILDKIDGLTNNPRISTQPAPATTC
TGFDSNTGRPIFGQNGIMSPINYQPTTGGNFNSLGNGATATGAEIYGIMQMLKTFDGEAS
EYPLFMSNFDILVHNNPSIPPIMKQSILLKLLTGKAADEMQSARISEADYYVLRDNMARQ
YDQNKFQQDILFDKLKDIKFDVRNIEKMESALNQFCNISNKLKRLNVQVDDQFYLKEFIC
KLPRAMRNKVNKKYQTGTATFASLRETAYDFIAERKSSERLDRQFSDGKDDAETVQINAV
DSSRFQKKDYNSRSSGFKNQSNFNNESHERMKRGRFNPPCRKMPCCYCEDKEHSAMQCTI
PVCKKIEFVAKKKLCFNCLSDSHTVGKCKSKFNCFHCHGRHFSGHCNGKTRMMKNWSSSY
FGARGLRPPINESSIKDHSISGQSSSKFITNVDTKSETSDREYEEVQNNAVWDCFGPAEN
TTEESSEPEYEDSQHQLSSQHIRIHVTKLTDAEAQLPFMHLVTPCGNNLVALVDTGAQTS
VISTSTAKRLNLTAVGKRMMAFSGFVSDSDPEWCTYYRLEVVDHNGKKWAMSVPSFERMN
TRFTPPAFTDEDRNYLEEHDLRVSGITNLEKATGKPIDLILGNNVLNKIKKLEKTTAHNL
PSGRSIEKNLIGFVNHPPIIEKAFVPAEETININLLGHVEYQSIHTVDSLEYHWNPTTTP
SHTISNSKLHNMIEQGMSLETVGIEKPALVKSKEALNEELIKEFKKTAIRGKDGKIYVAF
PYNGRQTELKNNYPVAIRRLSNMCNNQLKDEKPLREFDKIVQSQVEAGIIEVVTPEMDDD
GPIYYAPTGVVIKEDSSTTKLRIVYDASAHGKGDISLNECLFPGPALINQILGILMRSRL
GRYVMFSDIEKAFHQIRIQKEYRNTTRFLWLKDPKLGPTPRNIVKYRFTRLPFGVACSPF
LLAVTILLYCDIFPHEVNERIKENIYVDNIMFIAFSEEELMELYKKSKEQARRMHMNLRE
YMANSSEVMKNIPEEDRAANTYCKVLGHIYDRIKDTFTIKIAVPPEGIPTKREVIAFSAS
NYDPCGLIAPILVLLKKLIQKIWEKNLKWKDKLPAELMPMWKAVKEQFTDKTYELPRQLT
TNYNFTSLELIMFSDASKDHYAAVGYLRFGYDNKHFVTKLILAKSKVRPSKSGPEYTIPR
MELISMELASNAAIMLSKELHTKIKKVTLFSDSTCTLYWVISKTINNTGSRFVGNRVKAI
RQNLESLRQEQKIESTIRYVPTDQNPADIASRGCSVQELRESTLWEQGPEFLNQTEEKWP
SKMDGTPADPYAFRQMARDKGILQKETDEDIADRIRINSVKICEEFETIVPYKSTYNLMK
LTTTMANVCKFVNTLVRKRNQRRKNKKITFQGFTLRQYQQAEKDQNEIQKRVIARTFIIA
DHYKDAEVRMGKKCPQRLQPALQEDGLWRFKSRLGRASDHRITREMKEPIIIISEHPLAK
LILLESHESLHHQGVKDLITDVQRRYWIQKLGTIAKKVRDQCFKCRKQHAKPFAYPYTKM
LPPERTTLVGPFKYIGLDYLGPLYYNTTTSESGKVWVLLITCLVTRAIHLEVVTCNTSLG
FIDGLKRFIGRRGKPTSILSDNAPQFKLGYAIINHDLKTTVNNSATLTSYLAQNEIDIKN
TTPFSPWQGGIYERLIALVKNLINKVLGTKKLSFLELETLIIETEGILNSRPITPNKIDI
SDSPAIRPIDFISPNAEVALPENSSSFEDVIKQGATEKLTRQLMEKMKRIKEQLWDEFAK
TYFNAIRDYTPKSSEHSRLKPNTGQVVLVETKDKKRHEWPIGIIQEVTRRQDGKAHSVTV
KIGKRIVEKPVNQLIPLEDPGHSDDEVDRRNKTISPPQLDVCAYPNVLPHSPTRLPRKRG
RPPGSKSKIKKTSKSTNNRESLKYSSKSVSDQDQSTSLQKQSSKSVSDQDQSTSLQKQSS
KSVSDQEQSTSVQQQSSKSVSDQEQSTSLQQQSSKSVSDQDKPNSSVKKVQKLGSDQDKY
QCGQAETSINRQDFSNFKNKNNCHQKCQKLTRKDQVEDKTKKKEATVNWETAQKPRRPRP
RMPRMSSEEVRPFEAHQQDHQIKENRTRPYLSRRNCLIYETKTKTTKTTSSTITLIRMMW
KIQEKSERNLKVLKTRTITFVRLDLADQITKIHLFFFSFIRSFFFFVFFFTFC
Download sequence
Identical sequences 281687.CJA07984 CJA07984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]