SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA08002 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA08002
Domain Number 1 Region: 34-791
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.37e-271
Family Motor proteins 0.000000000112
Further Details:      
 
Domain Number 2 Region: 1179-1280
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.92e-19
Family First domain of FERM 0.038
Further Details:      
 
Domain Number 3 Region: 1900-2017
Classification Level Classification E-value
Superfamily Second domain of FERM 2.88e-18
Family Second domain of FERM 0.0065
Further Details:      
 
Domain Number 4 Region: 2018-2111
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000083
Family Third domain of FERM 0.03
Further Details:      
 
Domain Number 5 Region: 1799-1909
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000062
Family Ras-binding domain, RBD 0.077
Further Details:      
 
Domain Number 6 Region: 1272-1366
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000017
Family Second domain of FERM 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA08002   Protein: JA01639   Gene: WBGene00127206
Sequence length 2127
Comment JA01639 WBGene00127206 locus:Cjp-hum-6 status:Partially_confirmed
Sequence
MVLVSKGDFIWIEPGKVEGSIPIGARVTDQDHGRLKVIDDLGNEQWLSADRRVRLMHPTS
VQGVEDMCQLGDFHESAILRNLFIRYREKLIYAYTGSILIAVNPYMDIAIYTADEIRMYK
RKRIGELPPHIFAIADNAYTNMRRERKNQSVIISGESGAGKTESTKLVLQFLATISGQHS
WIEQQVLEANPVLEAFGNAKTIRNDNSSRFGKYIDVHFNESGSIEGAKIEQYLLEKSRIV
TQSENERNYHVFYCLLAGLTKEEKLELELGTAADYYYLIQVKKEMLCPLNGKTLTAEGRD
DAADLAEIRSAMRVLMINEQEIGSIFKLLASLLHIGNIRFRQNTTDNMESVDVSDPTILV
RIAKLLQLREQDLLDALTTKSLVTREERVISRLTGQQAVDARDALAKAIYGRLFIHIVRR
VNDAIYKPSQTKRTSIGILDIFGFENFESNSFEQLCINYANETLQQFFVQHVFKMEQKEY
DEENINWRNIKFVDNQATVDLIAQRPMNILSLIDEESIFPKGTDKTMLMKLHSTHGKNEL
YSQPKSELQRAFGVSHFAGNVFYNTRGFLEKNRDSFSADLSSLISSSKMPFLARLFDDLD
YDTSSRKKVTVGNQFRKSLEQLMAQLTQTYPFFIRCIKPNEMKRALVMDRDLVLRQLRYS
GMMETIKIRRSGYPIRHDYYPFVFRYRVLVPSIRGLVDRIDLYDAAKKICHRVLGANADY
QLGKTKIFLKDKHDLVLEKEYYRILKDKAVIIQKNVRRWLVRKDFEKQRQAAIAIQTAWR
GYDQRKRYKQIITGFSRLQAVLRSRQLVSHYQRLRTTIIQFQAVCRGTLVRRQVGEMRQR
GERAPLTEVSSADSVISDVQEEELVGHLFDFLPSDAKDSGNENDSTDSSRRGSFTRHHPS
PIMPSTIPKVDSFVDEDLSKYQFGKYAATFFQAQATATHIKKPLKNALLTHTEPSAQLAA
LAAWTTILRFMGDLPDVKPESTNGYEVYDKTPVMSKLYATLGKKFSSRDVEEAMIGSEYG
GTKTLKKGMGKKLISMTLKRKGKISGSDTSSISSDSAYSGFNAMLDNKPMTSLDKLHYII
GLGILKQDLRDEIYCQLCKQLSSNPSKLSAARGWILLSLCVGCFAPSEQFIKYLFCFIRE
RGPAGTGYSTYIEDRLRRTQVNGTRHQPPSYVELQANKAQKPVILAVTFMDGSVKTMCAD
SATTASELCKQLSEKIGLTNSFGFSLYIALFDKVSSLGSGTDHVMDAISQCEQYAKEQGR
QERNAPWRLFFRKEIFSPWHDLKDDPVSTNLIYQQVIRGIRYGEYRFDKEEDLAAVCAQQ
YYIDEGTMDVNKLESLLSSYLPDFELSGKEMASEKWTQTIMHQYRKKFTGRLPSQIEVKE
DVVCTAKTKWPLLFSRFYEALKFSGPPLPKNEVIIAVNWTGVYVVDDREHVMLEFSFPEI
STAYYVKGKRSTADTCTIRSVVGDEYTFQSPNSDDVTNLITSFLKGLKTRSRYLVAIKSQ
KGDGKCILFDTSNNSVTISEKNNFLEFEKGDLLILVNEFTGNTLLTESVVKGENARTCLF
GLIRAENVYVLPTLVKPSKSTLQIFPKNMDMTLDLYNNNKQVTVVDYNAEPYTLQTFAEE
NFNMHIKRVGSQISLMTLRRKEAQIESWKFSRDHIEQPLLKKLNGRDDASHGAVEIFSAI
MKYMGDEPAKRSRLGTHLTDHIFKLPIAMEVLRDELYCQIVKQLTLNPSMMSEERGWELL
WMTTGMFAPSATLAKEIQHFLKSRPHPIALDCQNRMQKLAKGGSRKYPPHLVEVEAIQHK
TTQIFHKVCKRCVFFPDHTDEAIEVDSATRARDFCHKIGFRLGLKSSDGFSLFVKIKDKV
LAVPETEFFFDFVRQLSDWVHTNHTKDSTMIPINYQVYFMRKLWFNVVPGNDLQADLIFH
YFQECPKYLLGYHKTTKADVIELAALILRAITKDNKNAPLAQIPQLIEELVPKDSLKMYS
ASEWRKTISNTYARVEHLKSDQAKTEFLNYICRWPTFGSAFFPVSQYSDLSLPDRLLIAI
NQTGVNIYHPESKKLLVQYPFNVICNWTSGNTYFNMTVGNMLKGNEGKKLLLDTTMGYKM
DDLLTSYISLMISNQNNHPAKRREMAL
Download sequence
Identical sequences 281687.CJA08002 CJA08002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]