SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA08806 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA08806
Domain Number 1 Region: 1185-1603
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 8.9e-124
Family Reverse transcriptase 0.0000385
Further Details:      
 
Domain Number 2 Region: 1824-1909
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.41e-16
Family Retroviral integrase, catalytic domain 0.022
Further Details:      
 
Domain Number 3 Region: 913-1013
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000457
Family Retroviral protease (retropepsin) 0.01
Further Details:      
 
Weak hits

Sequence:  CJA08806
Domain Number - Region: 737-775
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000802
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA08806   Protein: JA38989   Gene: WBGene00128009
Sequence length 2189
Comment JA38989 WBGene00128009 status:Predicted
Sequence
MLMGTLFVNIFASSLAQNNRNPFLKQYFVAKFVKIPSFYEKPEKLKRVVVSRDPSNYRKD
KETEKIEVFFDHDRPLVRRRREKVNKFTTPFVLQTRRRRRAKKETRRRRRENRFPPVTKK
PVSTGVKKTGFRRFFSELLSKSLIYETKTKTTKTTSSTITLIRMMWKIQEKSERNLKILK
TRTITFVRLDLADQITKIHLFFFSFIRSFFFFVFFLLFKKKQLWKSTVESDQHLSREREG
ARRNRKMLARIACGTPCYKRMEHHVHLSCDAVSDKASITTLRNAVCKDLHATHERISDVF
GRIQVRIEKLEKERASSAFTDVLPRAELNIHPETHPVKSLADSDSAKLQKLTISKQPRGN
SASPPGEQVNPRFSGKSEVAAPVSGKSREIPAVNTEESTSEKKSGVTSNETPARVVATMS
QSNGKAPAGPQEDVIVASQSNAAAERDAHHPLVNVIAQSDCQQAAAAPNKTGNTRSSSPN
SRITRAVSASQQPRVNVFAMKSAATVPIFSGTSKENFHAFVRNFKDHVRLTNEPDDREVR
NHLLTVLADFARDTAEEALDRNPDASSDDVIDALRAQYEDQYSTQNRLDAIKACFQYAQE
PVQDYYHRIRKLMREAQTGTNRTEVTQVAKEAFRIGLQSDIRFYVTTARSTEFDQIYKDA
IFFEKALQDKERKDRADTAVVTSRPRTAEVFAQAALRHQKLYYNSDDKVSYYPAANAFNQ
RTGNTNRQNQSGRGFSSNQNFNRRYDQNRTRSNNCWYCRISGHSRQDCRKREADMAQGIF
RNKIDKPINTPIRPHPSRNFELRRSPINPVENHQQPAVRMLQTTCESHRQPILVDPQEAQ
ARFEKQNRKIKMQANKMNDFKWRLESYQMGTSPGNSPLPRVNVTTTSETVSSQTTPTAAT
VRQVSESFITAQVPIRANGHPCHALIDTGANITVTSDVAKETFCNTPLEPPKSSTALGLG
GNAVNMVGAAVIKFQIGPFKVDHLTHFTEGRCTPAGPTDYTFIIGNDVLSQLPKFVFDYA
NARFIIGGAILPMGNQQERDSRPGNYRLYLGENTTFPAESEQRVKGILNKKLINHDMVVH
QQSDLFDRLGLSITPTVFRSQNALLLVTNPTRTDITVPARATIANVGRIHAAPDGSLHCS
DTASDEVFPNIATTDSRLQPLDPDFKIDFNSIQCKEEERRQLKQLCEDYADVLSRNPYDL
GSSKTDPVHIYTTSEVPVKSRPYRVPVKYQAELEQHINALIRSERITESNTPWISPIVLV
KKKSGALRVCLDFRRLNDITIPDNFPLPRIDAILEKVGGARYFSSLDMANGYLQLRLDAE
SSYKCGFITETKVFAYTHLPFGLKSAASYFQRALKTVLANMDRDVLVYIDDILIYSQDFG
QHIATLRNVFDRFRQFNLKVSPKKCEFLKKAITFLGHTITESNYTPNEANVKSIAEMSTP
KNLAETRRFVGMVGFFRKFLPNLATVAEPLTRLNRKNEKFRWETPQQEAFDTLREALLDK
PILAFPDYEKPFHLFCDASAVGLGAALMQAETEEEKHFKAIAYTSRTLADSETRHFRPYI
CLSNIILHSDHRPLSYLLSKHKVNDNLARWLIELQQYDIKIVHIDGKKNTVADYLSRMQG
ESQPKEAELEDIVSFPICMANTTYEHVPPTVLKISGMNSIDINEEQRKDPVLVSVRALIE
KRPTPCIDLPSEWKHYLKFVKISKRGTLVINFPGTPGLAEDKTIVPGALQELVITGHHAS
LLGGGHFHWRPTMHKTQKKFFWPGMRTSIIQHCLRCQQCQLRRSKPPAQREQQLVVPTNY
VFQRAPLLYDAICWFTRYVISXXXXEHFCALLEIQHHTAIPHHSRGNGATERTFRTFHNS
MAKYVNNKHNDWEDHLQAVAFAYNTAQHSTTGESPFYLMYGRDPVFPIEKIIHPEPGNDA
TQDPHEWKHHLTTTIQQAWRDAADHTEIAQGRYNNTANLGARPIDVKSGDLVVMRNFKSK
VGLSRKLVMPWEGLYRITSLERPFAYIVECRRPTKPPRKVHLDQIKKFLETSTSTRPSHQ
QVDLSPAQLPPIARSATPMRTSGNIVASPSQNGPYTRAMPSSASRQPLPPPLVTGTAVNH
DDTPYVLRKTRRKPTPPSIVQRQQRASRQHTIHPRSSVINFANFAIRDTIKTRETATSPQ
KDHTLGLGRPDLHFDQRQGSGSIRRKRGE
Download sequence
Identical sequences CJA08806 281687.CJA08806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]