SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA08879 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA08879
Domain Number 1 Region: 901-1150
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.78e-84
Family Reverse transcriptase 0.00018
Further Details:      
 
Domain Number 2 Region: 1188-1349
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.97e-36
Family Retroviral integrase, catalytic domain 0.023
Further Details:      
 
Domain Number 3 Region: 634-744
Classification Level Classification E-value
Superfamily Acid proteases 0.000001
Family Retroviral protease (retropepsin) 0.066
Further Details:      
 
Domain Number 4 Region: 102-211
Classification Level Classification E-value
Superfamily Acid proteases 0.0000606
Family Retroviral protease (retropepsin) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA08879   Protein: JA36395   Gene: WBGene00128083
Sequence length 1368
Comment JA36395 WBGene00128083 status:Predicted
Sequence
RKMKNYECVLLDNIPADSREERVMEVDELEEALQLHEPNVGGPAVVNFSFNRSEASSAVE
SQRAKTVSVATGHQAKARAAGADKGQAENPVVENVSENLGTPTVEKGRIGGVEVGIVIDS
GATISLIPKSLWKNIVEINGKDWEKKCAVKAPIFESVFTANNQPMKLIHQVKLETSLKTR
TREVIYYVVDVERETVIIGTNAFKLMGISINIQGVPRGVKPTRDIRLLSESERSAKILVT
GVAEEQSDCLMTPLVESLAPAICKNDVTDHGWGVELNERVGSPEFKAPIDHACSVEEETD
AGMQKFSDLCTQLRQGREEKNQAICEFEKEYQTVFVLDGEDSGRISVAECEIELLKASQS
NRQTPCPISLAVMPRAKKRVLKEFSPSVNQEGNSWWSSAGALIENKKIVMPMKWNYQFPY
FFHATINRTSDGNPYVVRTGRDPQGPIKMDGEDADGINHSDVKKDKFFTTPKLPRAHRNA
KKQAQIELVEHNPRLIVSPKELQALVEKEYPQLSLSIILDTIRDLKNVSSVAKLRIISTP
VVDPEKVSLSEIRHSSRSEYVDLSKPIEEILKGNQQVCEDVGNAIRQDVMILHAPELQGA
TISLASERPSVGRVEVLSQSKAESPVVENVSQNLGPPTVEKGRVGGVEVEMVIDSGATIS
LIPKALWKNLVKSNGKDWEKRCAVEAPNFKSVFTANNQPMKLIHQVKLETSLKARTREVV
YHVADVERESVILGTNAFDIMGISMNIQGVPREVKLTRDIRLVPGSEKTVEVLVEGVVEE
QGDCLVTPLVESLAPAICKVNRDGKAVLRFFNFGETSILLRKGQIVATGEVEGFDIVQED
VEDQRWGKELNERVGSPEFKAPNGHVCSVEGETYAGMQKFSDLCAQLRRGQEEENLEIWE
LVKEYQDVFALDDKELGRTHVVECEIELSEEAQPIRQKPRPIPLAVRPEIRKMLSKMLCQ
GVIRESKSPWSSPVVLVKKKDGSVRMCIDYRKVNKVVKNNAHPLPHIEATLQSLVGKRVF
TTLDLLAGYWQIPLKEESKPITAFAIGSELFEWNVLPFGLVTSPAVFQAMMESVIGELLG
KSAFVYVDDLLIASTTIEEHERDLREVLKRLRQSGLKLRATKCHIAQERVEHLGHQATPE
RSATEEKKKFMWPKMRATIEKFVKACPKCICTNDHPKLVAPLTPYKTSYPLEIVACDLID
VGLSIQGNRYVLTIVDLFTKYGTAVPIPDKKAETVLKAFVDRWAIGEGRIPHTLLTDQGK
EFANGMFEQFTKMLNVKHIMTKGYNSRANGAVERFNKTLMHIVKKKVALPVEWDDQLPYA
IYAYNSIAHKTTGDTPYFLMTGRDPQGPLIMEGEDADGINYSDMEEYX
Download sequence
Identical sequences CJA08879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]