SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA09176 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA09176
Domain Number 1 Region: 32-61
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000419
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 
Weak hits

Sequence:  CJA09176
Domain Number - Region: 108-152
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0158
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA09176   Protein: JA21227   Gene: WBGene00128380
Sequence length 283
Comment JA21227 WBGene00128380 status:Predicted
Sequence
MKFEMLLAEAARANTILPQGLAVMPAPALTHQPKKTKGECFYCGIPGHFTNECRRRVKDR
ANGIFRRENKTGFNPRSQTGFNPRSQTRFFPQNNPITNHQIFANQPTVQTIQSAVPALHA
QMDALKAELEVRQNQINALIRRNDELAGSAPVTQSSNARVSCFRWSQTCLLTFLTLGSLL
TPAFAVDPLVCMPHSPQNYIRLPAPQDCSKASSPEPHPVVYKELTIYRPNTIAYESNGTL
CKIVKRVTKYSVNMFGVRSEESTVNQLTVSSEELPEYEEVFTL
Download sequence
Identical sequences 281687.CJA09176 CJA09176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]