SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA09666 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA09666
Domain Number 1 Region: 864-983
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-17
Family Second domain of FERM 0.0053
Further Details:      
 
Domain Number 2 Region: 224-299,340-441
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-16
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 3 Region: 459-576
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000118
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 
Weak hits

Sequence:  CJA09666
Domain Number - Region: 769-844
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00331
Family UBX domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA09666   Protein: JA01872   Gene: WBGene00128869
Sequence length 1091
Comment JA01872 WBGene00128869 locus:Cjp-max-1 status:Predicted
Sequence
MDSSTPSPLRSPEDEDLAAKSSRIRLWVTKRMKELENQNERLRAQNLRCTTQLQMLRSFT
EKSRKIKADMEMSRSITGTLPVLRDDNRVSDDSGLTSDDADRKQMSTSISECTPRVQRKT
NRTIIKNTSQGSSTSESSPCEEERPMPLPRRIHDTSNERDSLNSYADDYEYDIEETAFER
SVIKNGKCADYVNLYEFVAIKDDKVVYSEIVKNRSSEKEVSPALPSHQPKHWETRLIQAA
EKCLSVVDGADSEGTSVGPYCVSDLIHRSSDHQRTESPSSVKSSKFSRNSSARVSSHHSC
EETAYAIRDLSVRSDYYTPPDASSRCSGGTPNSRTSLIPSRETIEKAGYWTYLTDNRIKS
LKRRYVLLRNGQLHFYRKHGSRDEEPVTKLNVADIRSVSKIEQQGAAYAFQLITATEKMN
FMTESEKTTQEWVTTISAAIKATTLQEMASRVTPIDAAISGWMTRVKCGISKKVFGALVN
QKLMFFKNSNDLVPNGFICLQGAQICEKHNGPEEYSGSSDEQLETSKEHPNQRKTNDSLC
VQIANEDPVYLVLRTSEEKEKWLYFLKAASGSSALWGTPFEILVQRMMAENVADDSDLWK
DLLFTSGEEIPKDTMTSVQPSEKKKTLEISRACQLFVSVLMRPQAVQYHIDLAQNILSTA
VQHEYLKNEVYAQLIKLTNETMPFGLQGWKLLALTIPLFIPKQYSLLWLLRKHISRWVTQ
PEESDESRMAIFCESALDRCIRVGGRQEGPSRLEVTSILTRDVTRTKFPHSISVKLPNSE
YQIVEFDGSTEIGQCLSSLCLKLGMRPALLSGYALYIDDPQTHNVSLLKGKQKLCDALSS
WEVRSRDAHRGRVTSDCAAALSLRMRHYWSHLTMTETPIERQFLAWRAAEEIVKGRIPLS
NNLVESLCALYAQMVFGDVPNQNMTDQQFEFISQRFYPTRLIDVTCIKSLRVQIKSNWEE
LIGMSEQECVRVILQVLCKWPLFGSDLHEASMRTDNERKVYLALNDHAVCIIDRRHFDLI
RKIPYSSLSTFGQFQQDFMLTIIRPLAPGAHPEEAPKERLTFSMRKSEIEQLTLHLAEYI
RCQKLVWKVSK
Download sequence
Identical sequences 281687.CJA09666 CJA09666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]