SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA10241 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA10241
Domain Number 1 Region: 9-37
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000023
Family Retrovirus zinc finger-like domains 0.0067
Further Details:      
 
Weak hits

Sequence:  CJA10241
Domain Number - Region: 77-121
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0117
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 192-248
Classification Level Classification E-value
Superfamily Viral glycoprotein ectodomain-like 0.0288
Family Spike glycoprotein-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA10241   Protein: JA28741   Gene: WBGene00129445
Sequence length 255
Comment JA28741 WBGene00129445 status:Predicted
Sequence
MPAPALTHQPKKTKGECLYCGIPGHFANECGRRVKDRANGIFRRENKTGFNPRSQTRSFP
QNNPITNHQIFANQPTVQTIQSAVPALHAQMDALKAELEVRQNQINALIRRNDELAGSAP
VAQSSNARVSCFRWSQTCLLTFLTLGSLLTPAFAVDPLVCMPHSPQNYIRLPAPLDCSKA
SSPEPHPVVYKELTIYRPNTIAYESNGTLCKIVKRVTKYSVNMFGVRSEESTVKQLTVSS
EECQNMKKFLHCNHX
Download sequence
Identical sequences CJA10241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]