SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA10316 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CJA10316
Domain Number - Region: 140-170
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00106
Family Second domain of FERM 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA10316   Protein: JA26500   Gene: WBGene00129520
Sequence length 387
Comment JA26500 WBGene00129520 locus:Cjp-frm-9 status:Predicted
Sequence
MLFCIFGDLFKKKGRKKKNKKKANEFNPNYAKMRVNPKFTILSINSDEREIWRLLQQLPS
TTNFFVFDYWAIENDYEQYFKNQLCRFTCYFNSIISRVGDSLNVSRNDNKVNFSIDYLLD
DKLIDKVVKPKAGKKIIIFKFQDQVISGSLPCPKEEAAYLASIQLSVEEQWPSNKRTQTI
RRHLLKGQFGRIRDLAQKIMVTPWEVDQNLYCTPPRFPNESTTASRAQSVIEEIQHRSRA
PTLLRCITNTDGLMSEEMQAQCLPIDLRGDRRTIKLVKERKRKLFHSQVYESELGMKKLY
IQTAKKLAAFGCKVFQVKELLHGRTLRKTLRLLCLSSAQLCLLDGSTKLVLKRQHASTLQ
QWRVGGGVSKHQLLLEFRGTKWQLIGE
Download sequence
Identical sequences CJA10316 281687.CJA10316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]