SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA10414 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA10414
Domain Number 1 Region: 3-267
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.000000000000133
Family Reverse transcriptase 0.02
Further Details:      
 
Domain Number 2 Region: 324-396
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000000626
Family Retroviral integrase, catalytic domain 0.022
Further Details:      
 
Weak hits

Sequence:  CJA10414
Domain Number - Region: 553-634
Classification Level Classification E-value
Superfamily Stabilizer of iron transporter SufD 0.0222
Family Stabilizer of iron transporter SufD 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA10414   Protein: JA38304   Gene: WBGene00129618
Sequence length 690
Comment JA38304 WBGene00129618 status:Predicted
Sequence
MIADIEKAFHQVRVQSHHRNVTKFLWLKNHIEPPTPDNIVTYRFTRLPFGITASPFLLAI
TILRYMELNPQEIHRKIVQNLYVDNVTFTPDSPEECILDYTKSKNAFTNMHMNLREFLCN
HKEVMNQIPEVDRAQNSTCKLLGHQWDSINDTLTISIAVPPKGTPTKRQLASFQASTYDP
LGLVSPIMVQTKTLMSKVWETTTRWKDTIPAHLLTEWEAIKQTFQEKSYTFPRQVAPAQG
VMDTSLILFSDASKNHYAMSAYLRFEYQQSAVHTQLIYSRTRIKPSKSAHLTIPRMETSR
DNAPAFTLGYSMIYADIRTMVNSSQTLTSYLASKDIEVKQITPFSPWQSGVYERIVGITK
TMFYKIIGRLQLPFLEIETLLIECEGIVNSRPITANPITISDTEALRPIDFLLPQAHISI
PNHTGNQSSGKPSPTEKQTREYMKHLDTIRLQLWDKFYNELYTGKLAPKYKSKTHATTAP
QPNHIVLVETPKVPRYKWPLGRIMQLLPSKDGKIRSVIVRCNNTLIERAFTMNNLKIIVH
NEQPQKKKKTRQYGSLLASPQCCGRRVSIFTTMNNQHNEHVSDTSIYGKKRKKEADVTSR
SLVRNESIESFTRTPTVEQSSSHSRDHQQCDNILHVARHYKGRSFAHSHALRHSTHGINT
VFRATRLTMTSEVPHDSALVEAATATELSR
Download sequence
Identical sequences CJA10414 281687.CJA10414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]