SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA11231 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA11231
Domain Number 1 Region: 424-747
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 7.63e-106
Family Reverse transcriptase 0.0000659
Further Details:      
 
Domain Number 2 Region: 888-1042
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.14e-38
Family Retroviral integrase, catalytic domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA11231   Protein: JA30198   Gene: WBGene00130435
Sequence length 1249
Comment JA30198 WBGene00130435 status:Predicted
Sequence
MHTAINCNGKSLSSSASPTVDAQPEPPSLPMPPPTLAAFTRTMPTAISAISAVSACRRLP
RHSTGRPSSDHDPAPTKKKLRSSHLRPFVMTPIWRMDTCLPRFAGPTVVNSTHLLALKNA
AVVDFNNIATRMKESEERTAMEMRALAEQVDRRTTNIVSLERLVDQLRSRVIVLEEQAQG
FALVGESFVSRSSTEHSGVRAPVVESGKDLTVPDRSVEPSNPTDSVQNATSAAENSLAEE
HEEARESQAPHIPRVCVLGFKSTTSIGTYSGAFSESLSMFVRQFKDQMKAADAEASETAQ
VYAFLTFLVGNARDRAEEFLDGNANATVDQLVADLKATFENELTGKLKEAQFAKCRQERG
ESIEMYFNRVRILAAQAFRCENKQMIEKKARDAFLNGLEDTIRYNVKDKDPKTCKQALDE
AILKYQAELEKHINGLLLSERITESNTPWISPIVLVPKKNGSLRVCLDFRKLNEVTIPDN
FPLPRIDSIVEKVGGSKFFSSLDMANGYLQLRLDAESSYKCGFTTEEKVYAYTHLPFGLK
SAASYFQRALKTVLAGLEKDVMLYIDDVLIFSKTFVEHVATLRKVLTRFREFNLKASPAK
CEFVKKSIVFLGHEIGEDSYSPNQANLDAIQQMPVPKDLKAVLRFVGMAGFFRKFIKNFS
EIAEPLTKLNKKEQPFEWRVEQQQAFDKLKELLTSKPILIYPDYEREFHIFTDASAVAQG
AMLAQTTEDLDRFHVVAYANCLSRAKDEVAPLPDEELEDVIEFPVCMAIDRANDRVSKHF
TPVGTRKPINIASEQNEDEDIRIITTFLTSPAASIEGISEEWTPFLERVSLSDKGGGHFN
WRKSLHKAQKKYFWPGMRSEFLKWTLECIKCQQKQNPHPSKRELQQVVITSHVFETVGVD
LTGPLRTSTKGNKYYINMICWFSKFVVSVPLPDATCESIARAILEELVLKFGTPNQIVSD
NATSFTSAAFKQFCELLDISHHRAIPYHSKGNGATERTFRTFHSMIAKHVNKSHTDWDTL
LPYVTFNYNNTVHSTTGETPFFLIFGRDPTLTIDRILDPSPKSVKTDLRLFKESLTTTLR
DAWNEAAIRSREAQAVYQKKANEGAQGSIIKAGDRVMYKDHSNHKGLSRKLVLPWAGDFR
VVEVNPPTATIYDRRDSRKPERIVHLDQIKKISSSEEDIDTPVTEVDAVANDGENPEVED
RQEEVIRNPEPTVQTTSKTLSNQTETSPDIAPVRRNPQRQRKLPAKFKT
Download sequence
Identical sequences 281687.CJA11231 CJA11231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]