SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA11463 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA11463
Domain Number 1 Region: 3-325
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.33e-92
Family Reverse transcriptase 0.00023
Further Details:      
 
Domain Number 2 Region: 501-652
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.15e-45
Family Retroviral integrase, catalytic domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA11463   Protein: JA28783   Gene: WBGene00130667
Sequence length 802
Comment JA28783 WBGene00130667 status:Predicted
Sequence
NNEILEESQSTFVSPIVLLKKKDSSFPFTVDYRMLNSLTKKENYVLPSVTEILDLASGSF
NFSSFDFISGFFQIGLHKEDRPLTAFETEDATWQFRVMPMGICGAPNTFQKVARYLQKIT
NARLFAYMDDLLLVSSSEEGHLKDIEELLSKVIDVGLKLKLISRRFIRNFSGIASPLHQL
TEKDKEFIWTDKHQAAFETLKASLLSPPILIGPNLSKPFIIETDASLIAVAGVLLQRNDA
DQLQAIAFASRKLNKAERNYPPIEAEALAIVFSLQHFRQYILGTHVQVVTDHKPLTSLLR
RKDLNGRLQKYQLSIQEYDLEIIYRAGKANVIADALSRYFKDEVKEPKTTVYSTQLQINK
SPISLTEIKSAQQNTEWIRQAVVAIQDQHSTRKGLAWRRRFQLVDGTLRTRAKNPSRTMP
FVIPRNHPVKTKIIQRFHGSPMHSSHLGAAKTTALISQMFHWPNIKEDVTNALKSCVECQ
RRKTNPHETTKEPFEMTDKFARPGQHWNIDHIGPLPITENGNRYILVFRDPFSRYLVAEA
VKSQDAETTTEIFINRVITVHGVPRSITTDRGTAFTSNVFRESMEKFGINHKLTAPYHHQ
SNGIVERANRTIEECLSAYVNSTQSDWDQYLPMTVFAINNAPSTTTGFAPAEIVFGRKPD
LPENNILKSHHHFGENYSSNLQNRLQLLWRQVHENNEIIQPQYSRVKERMVQPGDSILVK
RQPPGNKLAPKLHGPFKVTDVKAKNVHFADSRKKERIAHKDEIRRLPRTADTEEREEEEK
IEEEEPPGGLRRSQRLEEKKRM
Download sequence
Identical sequences 281687.CJA11463 CJA11463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]