SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA12360 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA12360
Domain Number 1 Region: 831-1041
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 7.23e-62
Family DNA polymerase I 0.0000969
Further Details:      
 
Domain Number 2 Region: 363-806
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.94e-47
Family DnaQ-like 3'-5' exonuclease 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA12360   Protein: JA35180   Gene: WBGene00131564
Sequence length 1043
Comment JA35180 WBGene00131564 status:Predicted
Sequence
MFSLTESYVFRTWLASSFELNWTFNSGGAFGFPRRRKTDTGWLTRHSTANLAVRSTSVIS
QSLASKTNMKSAIERLKEARASGKAYRPDLDVADVYETVDDAEYEKIVSQRQQDNFVVDD
DGMGYVDTGVDFEDEYEDEYEEKSAKSSKKPKKEKKEKKKGGIHSFLASMPSTKKSAVDE
SKVKATLDDDEDLKDILEHLNDDNEEEEQEERTQRSQRNSNPFKRARSAESPETLTPRPI
VKKPKTMVKKSAPVVKPVVDDDDDDDDDYGVPEFEDLPEVPAPAPVKAVPAPIKKEVKME
VEPADDDDDFENPLHKEVKQVESSLAKFQVQEEAWTEQDAEDVKVEVKTGSEPFYVTRNG
EKAIRMYWIDAYEDVHKANGTVYLFGKVKTSSNSWESCSVVVKNIQRKVYFMPRARNLKS
GEEITGAELHNEIRETLKNRFNTQEFKCKMVEKELIRDESFGQNGGTKTPMMEVLYPADK
GKLPTDLNGNTFSHVFNTSVTPLERLLIEKKFFGPGWIELFNYADPRAKISFCKYEFEVD
MERMRNVKYLESEELESIKNECQQPPIRLLALQVITTLNEKKENEICMISTLFNAKSDLA
HPSSDKKCYKPRCLVTKPSGGSVPYDIEKRLDSQKMSSFVKKLPNEKALLTVFLAEINQY
EPDMIVGHDLSATISLLVARLEKLKLEKWSRISRLNRSISIGKIGHSKSGQWELTAGRMM
LDSKLAAMELTKSRSYDLTELASKLLDTRRREIYVNEIKQLYSDSKDLISLIGWSWNDLL
LSVGIVVTLNALPLYMQISQIVGGIASRTMMGGRAERNEYLLLHAFEKAGLIAPDKYNAF
ENKRKKALENPEETADGSDEKKNGKAQYSGGLTLILLLDFNSLYPSIIQEYNICYTTLEY
AKDSDEQLSVPQSTDVEGVLPREIRKLVECRRDVKSLMKTEKNEAKKKQLDIRQMALKLT
ANSMYGCLGFQFSRFYAKPLAALVTAKGREILMHSKDLVEKMGYSVVYGDTDSIMINTNS
MDLMIPKKLGLEIKKAVNKCHRX
Download sequence
Identical sequences CJA12360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]