SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA12454 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA12454
Domain Number 1 Region: 268-398
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000271
Family Third domain of FERM 0.0049
Further Details:      
 
Domain Number 2 Region: 148-258
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000393
Family Second domain of FERM 0.01
Further Details:      
 
Domain Number 3 Region: 47-153
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000806
Family First domain of FERM 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA12454   Protein: JA31176   Gene: WBGene00131658
Sequence length 934
Comment JA31176 WBGene00131658 locus:Cjp-frm-7 status:Partially_confirmed
Sequence
MDSPGSDGTESSSSSSRLPVHLQQPSSSSSSFADPEVFTSTHNIRPGQTFVSVQTLTKES
FHVVVNSKTKVHDVLWKCGERLSLSEDKLFGLAFRQPTEGIGGDQPRHEYYFLDPAAKIM
KYAQKQPRFANWKSRSSENRPILTLYFRVRVYIDQVGLLTCPKAREHYYLQLKDNFLDHW
AGRHSVSEERCWYMAALALITDKGEGYLGFFRAEQYFPLWVINERGLEYIRNNLPAACED
IINEGRYKAMEKFMIEAGRSPFALNCHLYGLRRHKMDNTDNAVLGINAKGIEMCDIGENG
DRIPLRALHWSKVAKLSFNRKKMTIIGSDGTKMSLYAQTEHKARYLLELCKAVHQTLLVM
SHLHATMAPPPKPYLEMSVDGISTSSTSGIGSGDHDKDSDSLSSTCGDRCHGSMSSKLRL
RIKMDSNLDVKIEKMELDHIRQERAASQSSKASDESERSRFEMRHQTYHPANESSCATVS
SSHTVTTPQESRPSSMDNASQTIESESTKSVVDVNFNNKGGSRDSPTMNRGPIPGSPYHV
AISSKENATTESTSSPPATLTAEAASTDSINERLLSMSASDLRAMAERSYSPPAQWQEDS
SYREKISRSETRIDSQHHEMWLNQPMDQNGLNGTGGRFVKKNSAGSRAANAINRVHSMPS
HYHVNGFYRSNNHPYDDVQMQNGPNPTTLTHSHSVHVPGATPIRPRNPPPYEPPSFTAAT
YTPAKPILSTSPPQQPPPMPIGPLTAEVAGEQQASFPPASVTPTQFLEEVGAFSTEKMRN
YPLILQLLKEHRQSMGQLNAIPNRSPPVITHVPVGFYVNATPTGILSHHRRPSSCIDLSS
LNGGIVNGYGDGEGDAFVLPSQRGDFYFDSTTLSQNLHFVPVTKQQQQQQPHQNQQQQQH
QHQQQQTASRIEQNNGNLILPPPPPYQQPQQLVN
Download sequence
Identical sequences A0A2H2ID91
CJA12454 281687.CJA12454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]