SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA12502 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA12502
Domain Number 1 Region: 387-820
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.87e-135
Family Reverse transcriptase 0.0000609
Further Details:      
 
Domain Number 2 Region: 1013-1165
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.09e-37
Family Retroviral integrase, catalytic domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA12502   Protein: JA36201   Gene: WBGene00131706
Sequence length 1947
Comment JA36201 WBGene00131706 status:Predicted
Sequence
MKRYSFLTFLTGNARDRAEDFMATKAEATVDEIIGDLRLTFENELTGQLREKQFNKCRQG
RGEPIEAYYNRVRTLASQAFRAEDRATIEKKTRDAFLDGLEDSIRYNVKDKNPRTSRAAF
DEALRQEILRDDRAAAAQHAPTAAIFEEIRVLNEKWDSQHTQRKNNRRPGPQNKPNNSGF
QGKSKFQATTDNDLQSQLEMYRQQVAELQRLNTELLAEPGRGRTTSCLSWPAAGNPPAVV
TMDRVNSARLPSAPLTTQIPAETLHVGEEIIPIGKNHVEYTPKVLDIRVSEDTIVPAQSE
RVLACQEPMSTDMCDTLFLVTSQNLVNRSLLTAPVLINNKNVRILVTNPTDCDIFLAKNT
KAEDPKFRISLDKAVCTEARKHVLLNLFAEFHDVFSKNAYDLGSSKTDPVHIYTNTEIPV
RGRPYRVPVKYQAELQKHINGLLLSERITESNTPWISPIVLVPKKNGSLRVCLDFRKLNE
VTVPDNFPLPRIDSIIEKVGGSKYFSSLDMANGYLQLRLDDESSYKCGFTTEDKVYAYTH
LPFGLKSAASYFQRALRTVLAGLEKDVLVYIDDVLVFSKTFESHVQTLKKVLSRFRAYNL
KASPTKCEFVKKSITFLGHEINECNYSPNEANLHTIKQLPVPTDAKGVLRFLGMAGFFRK
FIKNFSNIAEPLTRLNKKDVPFEWTSQQQEAFDTLKQLLASKPILTFPNYDKEFHIFTDA
SAVAQGAMLAQTTDDPNQFQAIAYASRTLSDTETRYPAIQIELGAIIFALRHFKPYVYMS
KIILHTDHRPLKYILAKQKVHERVARWLIELQQFDIEIKHIDGKRNTVADCLSRAKDEVA
PLPEEELQDIVEFPVCMAVKNSKDRVPSRFTQAGTQKSLDIALEQDKDKDIGVIKRFLEK
PTSPIDDIASNWIPFLEHISLTSRGILVVQFAGEPARVAIPVSMQLLIFESFHNSLLGGG
HFSWRKTLHKAGKKYFWPSMRPDFLKWTLECVKCQQKRNPHPSQREMQKVVVTCQVFETV
GVDLTGPLRTSSKGNKYYINMICWFSKFVISVPLPDATCETTSRAILDELVLKFGTPNQI
VSDNGPAFTAAAFKQFCELLEIGHHRAIPHHSRGNGATERTFRTFHSIIAKHVNNTHTDW
DSVLQFATFCYNTTVHKTTGETPFFLVFGRDPTLTIDRIIDPAPKSCKTDIPLFKESLVT
VLQEAWEEAAVRSRKAQEEYQKVANQGAKGSEIRPGDRVMYRDYSNHKGHSRKLTLPWTG
NYRVISVNHPLATIREVKNHGKPARTVHLDQIKKFWATEEEDARSTPTLSDAEEPTEDSD
IDVTTVDPTPIRPTVSDARNPTTTQPDGQRRYKSQRYDDNFFLAMPKRPKESTQPPAKHN
REGPAEDEEAVRRTGAPGSEEPAPPDGEETVAMDTTEKEETAINHSDTTTIFLAMPKRPK
ESTQPPAKHNREGPAEDEEAVRRTGAPGSEEPAPPDGEETEAMDTTEKEETGECSSFANT
SSAVMRSSPRAKSTAGEGASIGEGAENVAQPDTESAVMRSSPRAKSTAGEVVPVEVDDAK
NLGLIVQDPSQENDEEDLLNPLMVDADMLDNELEAPVIELDERELLGEVPAPVAEAPVPA
VPEIPEEAPAAQIPAEFELPVYQDEHPFADFYGHEYTDELPKFPTAKAVAMTTLSQIQRA
RNETIACITAPDVMIERPNRADATGPSVFRTSLDLTSDLIIAVIVKNMGGYLIASPALRE
YCADDRGDLFTLLVNEFSYDYLSQTYTKISELHVGDVISVETIFRRQGYTPAQWSPVPLP
IDRVRETFFVVGRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCALSLRRTITRSSGHSRSPCTFAH
GPDYAKQPAARTIDDRRRPGLRPGTWP
Download sequence
Identical sequences 281687.CJA12502 CJA12502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]