SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA12748 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA12748
Domain Number 1 Region: 434-849
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.34e-27
Family Reverse transcriptase 0.013
Further Details:      
 
Domain Number 2 Region: 1159-1327
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.4e-17
Family Retroviral integrase, catalytic domain 0.036
Further Details:      
 
Domain Number 3 Region: 125-188
Classification Level Classification E-value
Superfamily Acid proteases 0.0000113
Family Retroviral protease (retropepsin) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA12748   Protein: JA31054   Gene: WBGene00131952
Sequence length 1634
Comment JA31054 WBGene00131952 status:Predicted
Sequence
MHFGLTTTTMWVVKRGDVCITHVVGPCLRRQAREQQHRSTCHPLIILLPIVLLIIPQVVL
LIQKPNHTPPVSLIPKLIMLLVPKSKDSDDPEKFLKHLSETKSHINHAATSVSSNDEDYK
LPFFCLFTPEGEPICALVDSGASLSIIDHRSAERLNLTLLGSTEITVAGFGSTVTIPSNA
YKLTLQNNTEEDPIVLQVAGSPQLPPTQFRTPQLSKEDIKYLKKRKIWSQSQAIEDQEHL
TGKPIDLILGNDVISWIQSQPSTKRHVLPSGRLLEATIFGNIVYPTPNLGLLLRSSQILE
DMALKRSEDQNYIMTILLDRTEPENAMTKLIAEVAQLWNIENIGMTSPSQEDVLQKEARD
LIAEFNQNATFNELGEFEVALPLNGNENRIADNYDIAYKRLWSLDGTLTKGKNLKHIYDE
IIKEQDLKGIVSKVTKRMMKEAAEKGYLVYFIPHKAVIKLMSLTTKVRIVYDASSHKRDE
LSLNDCVFPGPCTLMSIFGILLRARMYKYLVVADIEKAFHQVQMQEKFRDLTRFLWLKDV
NKPPTPDNIEIYHFRKIPFGLACSPFLLNSTVYYFLDRNPHELNEMTKENLYVDNALYYT
NEKAEIQKIVCGAKKIFDDMPMNLREFIVNDSEEMESIQQKDRAESTTVKLLGYSWDTIE
DTWTIKIASLEEEHPTKRQVASRLAETFDPLGLVCPILVAPKRTMQECWIDNAKWNDPIR
KHVLPSWKKSQQTFKDKTMTIPRQVVTNYSNSTLRLIVFSDASQDIMGACVYTHFSFNEG
EPVVNLFCAKNKIKPAKSESWTIPILELTAIGIGSNLAAKVIKEIRIPVVEICFMTDSAI
SLFWLLKKNITRPLVANRVKAYYENKDFLAEKNVEVSIRHCPTKENPADIATRGMNTTEL
QKSTLWFHGPDFLKKEREEWPSKIEGAVENVKEFHDKVFEDIVETETPKPKQKKTPRPQK
RVETVLTVSQKDTSVVPFHRTKSLRKLVSYMHRVLLVIQKSLPNYHWETYVMKEFAQSNP
DQLTHRRKMARTLIIQQHYEDSERLGYTFPPDLNKYIGEDGLYRIKRQVKSSVLPQEAHE
PILIHSKHILAELIVRETHELNGHLPETYTISALRTKYHIQGDRRIAKRVISSCTKCKKV
IGKAFAYPNSQVLPSLRTEPSVPFQHAGIDYLGPVPYIKDDGREGKALVLVYTCLVTRGA
RLELVPDATTERYIESLGIVFSRSGIPKVMYSDNATTFQLGEKLLNEDIAGEEPSESLTS
FLADREIEFLKITPLSPWQGGVYERIVGLVKHQLQKELGRTILDFQSLRRVLAATEAMIN
SRPLTPFKKGNDMVTIRPIDFLLPGALLEAPESSKPYDPRQSKAEKRTRAHMRKLEEVFR
RIWKFWSLGYLLHLRESKHKGKRCSTLKPKVGQVVLINTNLVRRHKWPLGIITQLCQSRD
GEIRSAIVKCKGKLYKRAVCQLIPLEIESCEEEVLQQETPRTENDSQFKSRPIPPTPAIF
DIPKAQYMPKEFLDSEEPDGSPEAFPSAAELPIVGELDVDEEEIDYDAQDIETEETEGEY
RDPNMTPEQRLEYSNRGLPERRTREYLPRKAKERKVPYVNYVHAAVVTYLSSSRPPECCQ
FNAHMNELANLKAI
Download sequence
Identical sequences 281687.CJA12748 CJA12748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]