SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA12809 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA12809
Domain Number 1 Region: 744-1108
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.89e-119
Family Reverse transcriptase 0.0000528
Further Details:      
 
Domain Number 2 Region: 1291-1367
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000000212
Family Retroviral integrase, catalytic domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA12809   Protein: JA23978   Gene: WBGene00132013
Sequence length 1580
Comment JA23978 WBGene00132013 status:Partially_confirmed
Sequence
MLAATTEVDYPYFPFRIAIDFVLVHKNRESQSYEKYREFFENAMQREGLIVRHQQFGHTN
FTLIFTPFHRLAREAEMSQMSFPLKDCQIKPGMPSCCVPLSKIFVTDDSVRQVNAPFQRR
NGPLFFNYTDEKSFFTPAQKGYLTYQILTKIDISKDLINDMKVFPTGLHETSTTSSITSD
EQLRRKGLSWLLMQNVYDEAFVLHAPSKEEPYFKEIQNGSMKTYNEFIAEIDLDPRKSLS
DSWERWYKFQPLNKIRDYFGEQIAYYFAWQGTFITLLWPATIFGLFVFIYGFIDSIKSAP
LDWNHCKLVNFRGETENVACGMRNGLTLFFSTLTQWFMSSFDTRMNAFFAVFMSIWGSVF
VQIWKRNNSVLSYQWNSDDFHAIEPDRPEFRGSKVKEDPITGEDIWISPALIRYLKMFAS
FCFVSFSMLLVIISLMLVTLLKIWMIYNFQCNSEYTFNCWLSSAFLPSVLNTLSAMGLGA
IYSNLVEKFNAWENHRTESEHNNSLIVKIFAFQMVNTYTSLFYVAFVRPESHREMPPTIN
DWKEKCEVLAKPHFKLMNASKLAMPVQEQIKLDIKIKDRKAEVVFQIVQNDAEVFLLGTN
AFKTIGVELKWKAEKAVARTAEKLRVPPQTCALIAVKLDANLGKQVLLESSEDWIASSLC
AENENGVLTAVVANWKDHPLLIKKNHIVGVVSRDWEICTKRKEMPVNMLELEQKPILRGR
ERNYQILKMLEVNGEISDGAIQNIILEYADVFAIEDSELTQTKLVQCKIELEKSNPIRQK
CRPVPLALQEKVRLMLEEMERRKVIRKCTSPWASPVVLVKKKDGSIRMCVDYRKLNTAIR
LNAHPLPHIESTLQALGDKRIFTTLDLMAGYWQIPMEEESKEKTSFTVLNEQYQFEVMPF
GLATSPAIFQAAMEQVLGELLGKSVFVYIDDILIASRTEREHANDLAKVLGRVREWGLKL
KAQKCRIAQQAVEYLGHVVDKNGIRTDGKKVEKMEKFPVPNNRKELHSFLGLCAYYRNFV
LNFADIAAPLTPLTSPKVAWRWTEDQQKAFDELKKRMTTAFKHFIFGCPTTVYTDHQPLT
SLFKSKNLADRLLRWSMEMQDFALNIVYLKGKANAVADALSRGGAQESEELKEANKQIKV
EIERVINMVEVEEKKVREGNGWRTMLEKDPRWKNIIMRLEKGETEGNVEVTGDGQRDLKE
FILIQEELMMVDKYGATMRVVPEEKRKMVFEEAHSGPFAGHWGADKVTAMLEKKLWWPKM
KAWIVKWSRECEQCLCANAKRILISPLTPIEASEPLEIVALDLLDLGRSSNGNRYALTII
DLFSRYAGACAIPDKKAETVTKAFADNWMLNEGRIPKAILTDQGLEPMRSLLLFFSSAFL
ISAKIDHVKEKNSEAHGDITKLKTKEAPEHVDHKKLFTDNFKNRRIEHQTALGSIKTIEK
EKRRQFLEDLLKNVKNLLQESRETLERTGQRSDSPFPHNSDLLKDALSKATNLIIFNWNF
EYFSFTKTYNYSIKTGIFDEKTAEKVKLMAQQHELIEKTENYFNAYDKDRARENVEAEET
QRKQKKLSKKADSKQPKGEL
Download sequence
Identical sequences 281687.CJA12809 CJA12809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]