SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA12902 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA12902
Domain Number 1 Region: 719-1140
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.04e-62
Family DNA polymerase I 0.01
Further Details:      
 
Domain Number 2 Region: 470-559
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 8.36e-19
Family Recombination endonuclease VII, N-terminal domain 0.0036
Further Details:      
 
Domain Number 3 Region: 515-642,682-709
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000212
Family DnaQ-like 3'-5' exonuclease 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA12902   Protein: JA32117   Gene: WBGene00132106
Sequence length 1200
Comment JA32117 WBGene00132106 status:Predicted
Sequence
MGTVDHAKLTRDQLRSLLCAHPKFSYAQTKNMKKNEIIEQLDILDREQIMKEIEGDSKFK
MRNMFPFDKTVFSNYKEVEDVLRDTIHTGDSNSIDSFLNKKETEILNDIYENSVKIYITL
ECEMIKEGTEDTQVAHLTTSTTVLHEGDDKKEYIDTVKIDLKNRLQHFQGRGSGFRLNRI
IGLRMYQTRIKPLSGSKYIELPDWIKNKKAVVNIKNDDNLCFKWCILAHLFPVEKDGQRV
NKYKEHASKINFDGFEFPFQVKDLDKFEKRNKLAVNIVTHNVGDDNRIESYKVSKNIKVD
ADRVINLLLITDSSGEGHYCLIKNIDRLMNGRNGTRNKFCIRCHNNFSTEENYEKHLGDC
MSNAPMQMIKPSNDYIEFSNIQKTQKHRFVCYADFESVIYKIAGVNNSLDKSWSENVGKH
TASAFCVIVVDSFKQTIHEIKSYVGYDTILKFNEYILDVCERLLSMPDMEMKNLTDEEWE
EYDSCKSCPHCGKAFQGDKVRDHDHWTGLFRSAMCNSCNLLKQKNKFIPVFFHNLKGYDS
HLIISDEKSSKMLEEKNVEIKSISANIEKFISFSYHFHNKSRRCEIRFLDSIGFMPSSLD
YLSNNLQDDECVITKSYYKNENTFKLLRRKGVYPYDFMDSYKKYSNTELPPIENFHNTLC
SKDISNDDYEYALRVWKETSCKTLEDYTRIYMINDVLLLADVFETFRNVSLKEYKLDPCW
YYTSPGLAWDAMLYKTGVKLQTIKDVEMYNFIEKGIRGGMCNAMVRYSKANNKYLPNYDP
KQESKYLLYLDANNLYGWAMSQKLPYDEFKFIKPPAFNKEFVENLNSQGRGCILEVDLDY
PDSLHDKHNDLPFCPNNKRVGSTNKLTNDFSPKRNYVIHYKSLLQALEHGLVLSKVHRVV
TFKETNWLASYIELNTNLRKNAKNDFEKDFFKLMNNSVFGKTMENVRNRIDVKVVSDMNK
VMKLAASNNFKQRHIINKNLILVEMLQKNIKLDKPIYVGMSILDLSKFLMYEFHYDVMLP
KYSSNLRLCYQDTDSFIYEIKTDDVYEDMMSMREHFDFSDYPKDNKLHNIDNKKVIGKFK
DELNGKLMVELVAFRPKQYAFKINDGSEEKKNKGVKKNVVKKEMTFNDYKHCLENRTIER
RTQMLINSTRHNIYSIKQNKVVLNNLTDKDKEAKRYAVDNIETLAFEHYRINSHYRIKNV
Download sequence
Identical sequences CJA12902 281687.CJA12902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]