SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA12975 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA12975
Domain Number 1 Region: 688-840
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.19e-32
Family Retroviral integrase, catalytic domain 0.017
Further Details:      
 
Domain Number 2 Region: 485-629
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.39e-30
Family Retroviral integrase, catalytic domain 0.019
Further Details:      
 
Domain Number 3 Region: 340-433
Classification Level Classification E-value
Superfamily Acid proteases 9.76e-16
Family Retroviral protease (retropepsin) 0.012
Further Details:      
 
Weak hits

Sequence:  CJA12975
Domain Number - Region: 280-317
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000419
Family Retrovirus zinc finger-like domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA12975   Protein: JA28944   Gene: WBGene00132179
Sequence length 1170
Comment JA28944 WBGene00132179 status:Predicted
Sequence
MTKAQNQEALTEALAALMTQLASSNELHRQLMEENRALRDAASAAEPPRATAGGTRASNH
VRLMADLSRRIQKYSYTIGEPDSFRRWLTRHEPIFEEDGSELSEREKTRLLLGSLEETTF
HRFVDSQRHVEDIYDVTFKETVVALTKIFGAQRSLMVQRQACFHISRSSGNWEDPLEYTN
HIGQLVADAKLATMTADEWSVFLFFRGLDAPGDAAAKIYLMQFTEMTERKGETITLSQIH
DEWMRFLQIKQQTKIVATSKQNPQTPVEVWKLEASKTKRRENPRFTPKWGSKDRRPAFCA
YCKRAGHHISKCFLKRKDEGTETQSIKVDVVNAELSAKRSVRVNVNGKPLQFDLDTGSMI
TLINSKSWKFIGRPPLERVEHRISCANGSEMRVLGRARVTFALKGSEYKGYVYVRERNTN
LIGMSWLSQSPLMRNAMDVMVNQIEIPSAGMARLKDNPTVRSGNCQQNTKRTRITPSKPC
PDTKKPWAHIYVDFAGPINGFWFLVVEDSKTKYAEVKLTRKASAAATVDLIEEIFATHGY
PDWIVSDNETQLSSHLFKKMCESHGITHKTTATYCPRSNGAAERFADILKRGIAKIKGSA
SINQRVLNNFLINYRNTPHAALNGATPADQSPLMRKAMDVMVNQIEIPSAGMARLKDNPT
VRSRNCQQNTKRTPRITPSKPCPDTKNPWAHIYVDFAGPIDGFWFLVVEDAETKYAEVKL
TRKASAAATVDLIEEIFATHGYPDWIVSDNETQLSSHLFKKMCESHGITHKTTATYCPRS
NGAAERFADILKRGIAKIKGSASINQRVLNNFLINYRNTPHAALNGATPAECHFSRKIRT
TRSSPILAERASENTEWIHYQNKMKGAYGKRNGARANTFEVDQKVYARVQHGNKWSWGYG
KVRKRVGSVLYEVQIGEKMQRCHANQLRQRHGDKGPEELFSDSNFPLFSDSMPAQKTNSP
KLIQNQRVSEGLRGETNLLRFPDFSSFSCNHPELDVVNSGRSPRVVRQGVFGSSPAAHDT
SRSDGFGRVNRGNQKMECRSELNKNQSPNSRTFLERKEEVSSPCKQQLESEEQQDVSRVQ
PAPNLSQSLRRSQHNRRAPFRYDPCSELQSHSEDRAPKRGSAPYSDRAAARSRGLHIASN
CRLAPSQGRTKDNFVKGEGVGKARGRPRWY
Download sequence
Identical sequences 281687.CJA12975 CJA12975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]