SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA13220 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA13220
Domain Number 1 Region: 208-346
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-34
Family Third domain of FERM 0.0000319
Further Details:      
 
Domain Number 2 Region: 104-207
Classification Level Classification E-value
Superfamily Second domain of FERM 2.49e-30
Family Second domain of FERM 0.0000397
Further Details:      
 
Domain Number 3 Region: 12-99
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.92e-21
Family First domain of FERM 0.00045
Further Details:      
 
Domain Number 4 Region: 526-612
Classification Level Classification E-value
Superfamily Moesin tail domain 4.05e-17
Family Moesin tail domain 0.0018
Further Details:      
 
Weak hits

Sequence:  CJA13220
Domain Number - Region: 309-487
Classification Level Classification E-value
Superfamily Tropomyosin 0.00314
Family Tropomyosin 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA13220   Protein: JA07288   Gene: WBGene00132424
Sequence length 612
Comment JA07288 WBGene00132424 locus:Cjp-nfm-1 status:Partially_confirmed
Sequence
MGGFSIFTRNAKPCYAKVSTMDADLEKIVIEKTWTGRHLFEAVCRIIGLRETWYFGLQFT
NKKHIPCWLQNDKTICNQDVQKDADGSFHFLFLVKFYPEDVEPEIILDVTRHLFFLQIRE
AILSMNLYCSPEASVLLASFAVQATLGDCTDEVGQIDLDKHLPKSVIDQYDMSADMWRDR
IKRWWSRNAGQSREEAELEYLRVAQDLEMYGILYYPICNTKETDLHLGVSAQGLGIYKGV
NRITPRPFFSWSEIKNIQFKNKKFHMKTVDKSTISFRSREPSIDSSILDLCIGTHNLYLR
RRQPDTLEVQQMRSQAKEDKQRRAAEMTKLSVERKERQQMERECKELKQQVELMSAELQR
AQESIRKAEEANDQMAEKARHSEHETLMLYKQKSEVEAECNRLSMNNMKSEEALLRMERK
AREAEILAKQMSMSLADVSVDANRKSQYSSQSALVIDPNWHPQQAMSTSGSYHQLQNYEH
QPSVMSRSLNMPPSAFSSPGSHAPPTNQPPYYNGVAPPPPDPSTMMLEQQTIRAELEQSR
SEYEKRARIFKEHLEELRGDIDGLKRENASGVHREHDAIHAQNVAHGFDKFTTMRMSMRG
TPRQRAQAFDGM
Download sequence
Identical sequences CJA13220 281687.CJA13220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]