SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA13355 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA13355
Domain Number 1 Region: 237-283
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000146
Family Retroviral integrase, catalytic domain 0.035
Further Details:      
 
Domain Number 2 Region: 2-55
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0000252
Family Reverse transcriptase 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA13355   Protein: JA39267   Gene: WBGene00132559
Sequence length 284
Comment JA39267 WBGene00132559 status:Predicted
Sequence
MMFALRRFKTIIYRTPTIVFTDHRPLMYLLKGTPLADRLLRWSIKIMEFNIKIVFLADKA
NSVANALSGGRCPLIEAEEIETAEMQNIISEIRRSDALVENALNSELWLDWLKEEEGWKE
LIQMLESGKTQGSVKIPGLKKEVFMEEYMLVGNFLRNSESEEYNRRVVPLKARHELIKQA
YEGCWAAHFGTEELWRQLSKRIFWPKMRAHIENVVKGCPKCICTNDQPKLTAPLTPYKTS
APLEIVACDLIDVGLSTQGNRYILSIIDLFTKYAVAVPIPDKKA
Download sequence
Identical sequences CJA13355 281687.CJA13355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]