SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA13428 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA13428
Domain Number 1 Region: 461-894
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.56e-137
Family Reverse transcriptase 0.0000481
Further Details:      
 
Domain Number 2 Region: 268-297
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000611
Family Retrovirus zinc finger-like domains 0.0052
Further Details:      
 
Domain Number 3 Region: 388-427
Classification Level Classification E-value
Superfamily Acid proteases 0.0000638
Family Retroviral protease (retropepsin) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA13428   Protein: JA37376   Gene: WBGene00132632
Sequence length 1129
Comment JA37376 WBGene00132632 status:Partially_confirmed
Sequence
MPTLSSFPFLSHCRPPAEAVHVIHVHCTSQLHYGNDEHSSSDGSVQMPRVNVLGFKSAAP
IGTYSGAFSESLSVFVRQFRDQMKAADAEATDAAQVNAFLTFLVGNARDRAEVFLNTNPI
ATVDQLVADLKATFENELTGKLKEAQFSRCRQERGESIEAYFNRVRLLAAQAFRAESSEV
MEKRSREAFLNGLDDSIRYNVKDKDPKTCREAFDEAIRQDILRDDRAASQQYLPTVALLE
EMRSMKQEWANYNNRPGKPHRKEKIEDNQKMKRRCYHCNNVGHFIRDCRKRMAGEPKVQQ
TNQDAVRNHQQHPAQVKVATTEDLQAQLEVYRQQIAELQRVNGALMAESGTHGVRSLTWP
TENAHTKKSKANFTVNSAHLAPVPLTMQIPIKVNGTPCFALIDTGSTITVAGQAFSRRIG
VPRLHQASAPHAIGLGEDPKFRISLDGAICSEEQKGILLKLFSEFSDVFSKNPYDLGSAK
TDPIHIYTSTEVPVRGRPYRVPVKYQAELEKHINGLLVSERITESNTPWISPIVLVPKKN
GSLRVCLDFRKLNEVTIPDNFPLPRIDSILEKVGGSKFFSSLDMANGYLQLRLDPESSYK
CGFTTEDKVYAYTHLPFGLRSAASYFQRAMRTVLAGMDQDVMMYIDDVLVFSKSFESHIQ
TLRKVLTRFREYNLKASPAKCEFAKKSIVFLGHEISETSYSPNQANLDAIQKMPIPRDLK
AVQRFVGMGGFFRKFIKNFSEIAEPLTKLTRKDQPFEWTSFQQNAFETLKDKLTSKPILV
YPDYTKEFHIYTDASAVAQGAVLAQVSKDTGIIQVVAYGSRTLSEVETRRPAIQIELGAI
VFALRHFKPYIWLSKIVLHTDHRPLVHILAKSKVNERIARWLIEIQQYDISIVHIDGKRN
TVADCISRAKDEVAPLPKEELEDIIEFPVCMKIDRSKDRVPRNFTPGSTQKPVDLALEQD
KDNDVNTIKTFLTSPATTIDGISEKWLPFLERVRVSETGILTITFGSEHPKVVIPRTLQK
LMFESFHSSLLGGGHFDWRKTLHKAQKKYFWPGMRSDFLKCLLEISHHRAIPQQNNRKQA
DIRFLKSIFLISFGKVREYFLNYFSKFQTDQSILRILDEFFAGFFLHFX
Download sequence
Identical sequences CJA13428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]