SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA13529 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA13529
Domain Number 1 Region: 485-638
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.53e-30
Family Retroviral integrase, catalytic domain 0.025
Further Details:      
 
Domain Number 2 Region: 340-431
Classification Level Classification E-value
Superfamily Acid proteases 3.19e-16
Family Retroviral protease (retropepsin) 0.012
Further Details:      
 
Weak hits

Sequence:  CJA13529
Domain Number - Region: 281-317
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00131
Family Retrovirus zinc finger-like domains 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA13529   Protein: JA25827   Gene: WBGene00132733
Sequence length 776
Comment JA25827 WBGene00132733 status:Predicted
Sequence
MTKAHNQEALTEALAALMTQLASSNELHRQLMDENRALRDAASAAEPPRATAEGTRVPHN
VRLMSDLSRRIQKYSYSIGEPDSFKRWLSRHEPIFEEDGSELSEREKTRLLLGSLEETTF
HRFVDSQRDVEDVYGVTFKETVAALTKIFGAQRSLMVQRQACFHISRSSGNWEDPLEYTN
HIGQVVAGAKLATMTADEWSVFLFFRGLDAPGDAAAKIYLMQFTEMAERKGETITLSQIH
DEWMRFLQIKQQTKVVATSKQNPQAPVEVWKLEASKTERRENPRFTPKWGSKDRRQPFCE
YCKRAGHHISKCFLKRKDEGTETQSIKVDLVNAELSAKRSVRVNVNGKPLQFDLDTGSMI
TVINSKSWKFIGRPPLERVEHRISCANGSEMRVLGRARVTFALKGSEYKGYVYVRERNTN
LIGMSWLSQSPLMRKAMDVMVNQIEIPSAGMARLKDNPTVRSGNCQQNTKRTRITPSKPC
PDTKKPWAQIYVDFAGPIDGFWFLVVEDSKTKYAEVKLTRKASAAATVDLSEEIFATHGY
PDRIVSENETQLSSHLFKKMCESHGITHKTTATYCPRSNGAAERFVDILKRGIAKIKGSA
SINQRVLNDFLINYRNTPHAALNGATPSECHFSRKIRTTRSSPMLAERASENTEWTHYQN
KMKGAYECNEEVSSPCKQQLESEVQQDVSRVQPAPNLSQSLQRSQHNRRAPLRYDPSSEL
QSHSEDRAPKRGSAPYSDRAAARSRGLHIASNCRGKVLGRHVAALVGINVVTYTWK
Download sequence
Identical sequences CJA13529 281687.CJA13529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]