SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA13834 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA13834
Domain Number 1 Region: 2-312
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.08e-98
Family Reverse transcriptase 0.0000805
Further Details:      
 
Domain Number 2 Region: 508-601
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000109
Family Retroviral integrase, catalytic domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA13834   Protein: JA28451   Gene: WBGene00133038
Sequence length 799
Comment JA28451 WBGene00133038 status:Predicted
Sequence
MANGYLQLRLDPSSSYKCGFITESKVYAYTHLPFGLKSAVSYFQRALRTVLGGLEEEVLV
YIDDILVFSTSFEQHLAFLRKVLHRFRSFNLKASPKKCEFVKDSITFLGHEISKHSYSPD
KSNVTKILDFPTPSNMNEVRRFVGMAGFFRKFIPNFSEISEPLTRLTRKNKKFTWDREQQ
ESFEKLRDALAAEPILGFPDYEKPFHIFCDASAVAQGAALMQTRQENEKEFTAIAYASRT
LSDTETRWPAIQVEMGAIIFALRQFRPYVCLSKIILHSDHKPLTFLLQKSRTHDNLARWL
IELQCYDVSIVHIDGKKNSVADCLSRALENSDPTDHTELRDIVEFPICMKVGAKPVPHLR
SLIARRTQHSLSLDIVEEQEKDTEIAKIREVLQGKATAASLPESQLERFALCSLASNGTV
LTKKTPNSKKEVIFIPKQLIPLIFNVFHESYLSGGHFNWRKTKYKIEKRYFWPNMSSDIF
ERSRACEKCQLKNSPTPAYREKLLAVPSSRVFQKVGLDLTGPLRTTELQNKYILNIVCWF
CKFVVSVPLPNRKTETVARALFTECVLKGGNRQRHHFLSDAFQSFCKLLEIHIDRIINPT
PDQCFDKDPTDFEDFREEIVSNLREAWTHAKQQADQARDQFTHSYNQQARPSNIKVGDRV
LFKNYKSSKSLSRKLVLPWEGQYRVIEINQPEAIIQNISHPSETPRRVHLDQIKKFFEIS
GPAATSVDDPTSSKEVAVPEKTHYEEASPETGVQVPDPNTQVETLNNPEVTTSESVSDKA
DPQSPYNLRKTINRPKRFL
Download sequence
Identical sequences 281687.CJA13834 CJA13834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]