SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA14140 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA14140
Domain Number 1 Region: 162-233
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000000000955
Family Multidrug resistance efflux transporter EmrE 0.014
Further Details:      
 
Domain Number 2 Region: 30-76
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000667
Family Second domain of FERM 0.002
Further Details:      
 
Weak hits

Sequence:  CJA14140
Domain Number - Region: 362-437
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00523
Family Multidrug resistance efflux transporter EmrE 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA14140   Protein: JA30186   Gene: WBGene00133344
Sequence length 466
Comment JA30186 WBGene00133344 status:Predicted
Sequence
MWETRLVRLCACGAHTFSKLDLPWEFSFEVKFYPTTPTTIVDDHARYYVFLQLRRDILTG
RLPATADTHALHGSFVKMAITKENAIKYTSLLVLVVQNCSLVLFMRYVMTSDRPKFLKTI
SVFFGEIFKCTVSLILACIEEKSVVKGLNRIYFEFVVNWRSTIKVLVPAAVYTVQNFLLY
VAVDNLPAATYMVTYQLKILTTAVFTVLVLHRRLSIQQWISLFVLFAGVVIVQYVVQDQK
MSNDRLKAEALVNISSTLAPSTIPPLSNFTSTLATVVAKTETKRTESSIIGFVAVLVACG
LSGFAGIYFEKILKGSNVSIWIRNIQLALPSIFFAFLFASVKDNSSLYGDGLNPLRIWNN
MLRGFDWAVWVTVGINAFGGLVVAVVIKYADNILKAFATSLAIVLNCIAAYFLFNFRPTL
LFLLGACGVIVAVFAYSIFPYTPSHQALPTDAPKGTELSNMENNKA
Download sequence
Identical sequences 281687.CJA14140 CJA14140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]