SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA14787 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA14787
Domain Number 1 Region: 116-556
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.33e-24
Family Reverse transcriptase 0.013
Further Details:      
 
Domain Number 2 Region: 855-934
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000000161
Family Retroviral integrase, catalytic domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA14787   Protein: JA14737   Gene: WBGene00133991
Sequence length 962
Comment JA14737 WBGene00133991 status:Predicted
Sequence
MWETDESPTETEISAVINGQSMNSRSINSTLNKLLERSWQLDLLGIEPPTAVKNKQTLNE
ELIKRFKATAVKDKDDKIHVQFPFNGKEEHLNDNYLVAVKRLISLVEKQLTNSVTRDAYH
DIIMQQLASGIIEVAPEAENQMGPHYFIPHRVIEKLDSLTTKLRIVLGASSHMKNELSLN
DCIYPGPSILKSIVGILLRARNKPFLMVADLEKAFYQVRLQAQHRNATKFLWMKNPHSPP
TPDNIIIYRFTRLPFGITASPFLLAITIILYMETAPEAINDKIAQNMYVDNVLFTPETAD
EALEDYRNSKRAFNNMHMNLREYVCNDSKVMSIIPETDRASSTTCKLLGLLWDSTNDSLS
IKIATPPEGVPRKRQLVAFQAATYDPLGLLSPIIVPIKLLSSKVCESKVKWKDPIPDKYH
QEWIQIKAAFTEKKYTFSRMVTQLKDIEKTSLIIFSDASKDHYATCAYLVFENMKGEKSS
TLIFSKSKIRPINSDNLTIPRMELLGALIATNAASTLIDELHIPISSVTFFCDNSAVLYW
IIHKKPVDKWVSNRIITITTTLNKLAEKNLNPKFRYVPTGINPADIATRGATLSELKINL
LWQNGPSFLVENEIKWPPSLDDTSADHQEFHCYILKIHRPAVPRGNTLLASENSLGYESI
VPYYKTNSLRKLVTITNKVLNWTVKTMIKRNARFPDKPYIWQNHTMQKYAIANITKNETK
KRALTLKYIINDHYVDSEYRMDIKPPVSEHIHKDNNGVYHYENSYVNKKNANLPKSLIYI
MHKHPLARLIAGDSHESLLHQGPKDMATDIQQRYWIKGITTLTRSIRKNCLICKRQHGKP
YKYPFATALPAVRTHACRPFQHVGLDYFGPIGYKTSSGNNGKLWAMLSTCLVTRAVHLEI
VPDNSTSSFLLAMRSLIGRRGTPKSIISDNAPAFSLGYAMINADLKSMINSSQTLTSYLA
SK
Download sequence
Identical sequences 281687.CJA14787 CJA14787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]