SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA14850 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA14850
Domain Number 1 Region: 25-458
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.34e-131
Family Reverse transcriptase 0.0000191
Further Details:      
 
Domain Number 2 Region: 633-785
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.39e-45
Family Retroviral integrase, catalytic domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA14850   Protein: JA25307   Gene: WBGene00134054
Sequence length 935
Comment JA25307 WBGene00134054 status:Predicted
Sequence
KEFDEEVNLEYTTLCNANREKLLELLHRYEDAFHYKDGAIGKFTGPIQHEFQIEAPLPKP
RKSRIPYGKREEVRIQVEKLKEQNIIEESQSTFVSPIVLVKKKDSTFRFTVDYRMLNSVT
KKDNYIIPSVTEILDLASGSFIFSSFDFISGFFQIGLRKEDRPLTAFETEDATWQFRVMP
MGICGAPNTFQKVARYLQKITNARLFAYMDDLLLVSSSEEGHLKDIEELLSKVIDVGLKL
KHSKCCFARKELEFLGYIIGREGLKPNPRKVEAIQSFPVPKTPTAIRSFLEMIGYFRRFI
RNFSGIASPLHQLTEKDKEFIWTDKHQAAFETLKASLLSPPILIGPNLSKPFIIETDASL
MAVAGVLLQRNDADQLQAIAFASRKLNKAERNYPPIEAEALAIVFSLQHFRQYILGTHVQ
VVTDHKPLTSLLRRKDLNGRLQKYQLSIQEYDLEIIYRAGKANVIADALSRYFKDEVKEP
KTTVYSTQLQINKSPISLTEIKSAQQNTEWIRQAVVAIQDQHSTRKGLAWRRRFQLVDGT
LRTRAKNPSRTMPFVIPRNHPVKTKIIQRFHGSPMHSSHLGAAKTTSLISQMFHWPNIKE
DVTNALKSCVECQRRKTNPHETTKEPFEMTDKFERPGQHWNIDHIGPLPITENGNRYILV
FRDPFSRYLVAEAVKSQDAETTTEIFINRVITVHGVPRSITTDRGTAFTSNVFRESMEKF
GINHKLTAPYHHQSNGIVERANRTIEECLSAYVNSTQSDWDQYLPMTVFAINNAPSTTTG
FAPAEIVFGRKPDLPENNILKSHHHFGENYSSNLQNRLQLLWRQLHENNEIIQPQYSRVK
ERMVQPGDSILVKRQPPGNKLAPKLHGPFKVTDVKAKNVHFADSRKKERIAHKDEIRRLP
RTADTEEREEEEKIEEEEPPGGLRRSQRLEEKKRM
Download sequence
Identical sequences 281687.CJA14850 CJA14850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]