SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA15148 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA15148
Domain Number 1 Region: 70-179
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.07e-28
Family Canonical RBD 0.0033
Further Details:      
 
Weak hits

Sequence:  CJA15148
Domain Number - Region: 22-63
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0671
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA15148   Protein: JA15435   Gene: WBGene00134352
Sequence length 206
Comment JA15435 WBGene00134352 locus:Cjp-pabp-2 status:Confirmed
Sequence
MSDTQIDEDVLGIDDITEDDADLSAIEGDLNEIEEEQKKLKAIQNEMVGHMNLNTSTQSN
SAQSLLTPEEKAEADAKSVYVGNVDYGATAEEIEQHFHGCGSVARVTIQCDKFSGHPKGF
AYVEFTDKDGMQNALAMSDSLLRGRQIKVDPKRTNKPGLSSTNRPPFRGGRGGGRGRGNV
IVKYIYSGGFRPRGRGARRRPGFAPY
Download sequence
Identical sequences A0A2H2IHD7
281687.CJA15148 CJA15148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]