SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA15220 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA15220
Domain Number 1 Region: 592-690
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.78e-26
Family Reverse transcriptase 0.0062
Further Details:      
 
Domain Number 2 Region: 683-781
Classification Level Classification E-value
Superfamily Ribonuclease H-like 7.97e-20
Family Retroviral integrase, catalytic domain 0.016
Further Details:      
 
Domain Number 3 Region: 388-488
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000000206
Family Retroviral protease (retropepsin) 0.027
Further Details:      
 
Domain Number 4 Region: 255-295
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000767
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA15220   Protein: JA35482   Gene: WBGene00134424
Sequence length 813
Comment JA35482 WBGene00134424 status:Predicted
Sequence
MAQLASSQSDKVSDNTTQSVHQEIDQGNDQEREDEQSPQLREGQVHRVNVLGFKSAVSIG
TYSGAFSESLASFVRQFKDQMRAADAEASDAAQVNAFLTFLVGNARDRAEVFLNSNPTSN
VDQLVTDLKATFENELTGKLKEAQFSRCRQERGESIETYYNRVRILAAQAFRAENNAVIE
KRAREAFLDGLDDSIRYNVKDKDPKTCKEAFDEAIRQDILREDRRASQQYAPTVALLEEM
RSLKQEWINTQSKPKDNFRSREDNRSKPVRRCYHCDKVGHFIKDCRRRLAGHPKVQQTNA
EAVRNHQIHRRPAQVNAATTEDLQAQLEVYKQQVAELQRLNGALLAESGAHGVRSLAWPK
NDRQEVKGKQNFTVNSAHIPPMPLTAQIPIKVNGNPCFALVDTGSTITVASQSFSKRIGI
PKLYQASAPHAIGLGGNAVQMVGAAFVTFSIGSHTVLHRVHFTKGECTPAGPRDYDIILG
NDILSQLPQFSIDYKQATLHIGREIIPIGTRHVTVTPQVFDVKVSEEVVIPACSEKFIRC
VKPTTAVVRASVFLVASQNLLNKSLLTAPAVVDPENVCILVTNTSDSDVTLLSDNFPLPR
IDSILEKVGGSKFFSSLDMANGYLQLRLDPESSYKCGFTTEDKVYAYTHLPFGIRSAASY
FQRAMRTVLAGMEKDVMMYIDDVLVFNNASSFTAAAFQQFCDLLDIGHHRAIPHHSKGNG
ATERTFRTFHAVMSKYVNKEHTDWDTILPFTTFSYNNTVHSTTGETPFFMVFGRDPTFTI
DRIIDPTPSARKTDIGWFKESLTTTLRDVWKQA
Download sequence
Identical sequences CJA15220 281687.CJA15220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]