SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CJA15241 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA15241
Domain Number 1 Region: 356-463
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 0.00000000000000188
Family Lambda integrase-like, catalytic core 0.011
Further Details:      
 
Domain Number 2 Region: 247-347
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.000000000000233
Family Reverse transcriptase 0.0069
Further Details:      
 
Domain Number 3 Region: 182-213
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000454
Family Retrovirus zinc finger-like domains 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA15241   Protein: JA37532   Gene: WBGene00134445
Sequence length 502
Comment JA37532 WBGene00134445 status:Predicted
Sequence
MAEQDERDRLLSLLGQDVMERMLPKVNEMLANKEEEKAPEIGQKGLMVQAELNAKMINML
RAAMDEEDPKKGIKDVIETLRQRNTELQLLDRNPEALKTVERMKAVAALTGTDADSQKLI
ALAQVLMDSSGRSARPTGSSAQWFRAPGSSYANGGVRSQPSSNFRRFGAQKRPGSTSSTS
LERGYGKIGGAGPECYACHSIGHFSRNCPQRRYSERGEAIRKVIFLGIENFELPPPEGLR
ESVKPNMTFIIAEISKLEESGVVVDEADPQVVSPLHLAMNGTKPRMILDLKKLNQALTPP
HFRVEDWNTVWPCLDSARFACSFDFKSGYHHIKVAEESSKLLAFSLSNPPGSCEASKNDQ
EANGRSTFVTYEEGSDLDILLARWKVRAKGSYVFPNHNDGSKLSPSAISSITKRIFESVG
IFNKTHHSIRRGAANAMQAQGFSRDQIKAKGRWRSDGGVARYLVDCPEAQGIPKLAIIGT
SANKESEEGDVDEGPPVLEKEF
Download sequence
Identical sequences CJA15241 281687.CJA15241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]