SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA15296 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA15296
Domain Number 1 Region: 509-671
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 7.19e-58
Family A middle domain of Talin 1 0.00015
Further Details:      
 
Domain Number 2 Region: 678-801
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.96e-46
Family I/LWEQ domain 0.0001
Further Details:      
 
Domain Number 3 Region: 2316-2507
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.47e-39
Family I/LWEQ domain 0.00028
Further Details:      
 
Domain Number 4 Region: 774-903
Classification Level Classification E-value
Superfamily I/LWEQ domain 9.55e-37
Family I/LWEQ domain 0.0012
Further Details:      
 
Domain Number 5 Region: 210-323
Classification Level Classification E-value
Superfamily Second domain of FERM 1.15e-24
Family Second domain of FERM 0.0000461
Further Details:      
 
Domain Number 6 Region: 324-414
Classification Level Classification E-value
Superfamily PH domain-like 1.63e-23
Family Third domain of FERM 0.0000491
Further Details:      
 
Domain Number 7 Region: 1859-1986
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 9.42e-23
Family VBS domain 0.0022
Further Details:      
 
Domain Number 8 Region: 2020-2145
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000518
Family VBS domain 0.011
Further Details:      
 
Domain Number 9 Region: 81-131
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000864
Family Ubiquitin-related 0.031
Further Details:      
 
Weak hits

Sequence:  CJA15296
Domain Number - Region: 1596-1673
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000173
Family VBS domain 0.064
Further Details:      
 
Domain Number - Region: 1486-1564
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000294
Family I/LWEQ domain 0.007
Further Details:      
 
Domain Number - Region: 2192-2304
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00165
Family VBS domain 0.047
Further Details:      
 
Domain Number - Region: 1111-1231
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0306
Family alpha-catenin/vinculin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA15296   Protein: JA31636   Gene: WBGene00134500
Sequence length 2565
Comment JA31636 WBGene00134500 status:Predicted
Sequence
MGVLSLTVSSAEKGIKKTMQFEPTTLVFDVAKLIRDKFAMHDVNPSEYGLFRVEEDLSKC
AWLENGRTLEYYLIRNRDEVEYKKKIRLLKVRMLDGAVKTISVDESQPVSQLMLTICNKI
GISNYEEYSLVRDDILLNGAGTNNSTWNLREERSKSTERGVYSTLGRKKEQKLEELRKKL
HTDEELPWLDHAKTLREQAISEEETLILRRKFFFSDTNVDSRDPIQLNLLYVQCRDGVLR
GLHPVQKETALQLGAIQAHIQYGDFPYDKPKFHLDGRDVLPKEYQKNKENEKKVVALYKE
LSGTAEIDAKSKYVHLCRELKTYGVTFFVVKEKMAGKNKLVPRLLGVNKESVMRVDEKTK
QILKEWPLEQVRRWASSGKTFNLDFGDYQDGYYCVQTADGEKIGQLIGGYIDIILKKKRT
RDHQGIEGDEGSTMLEDMVAPAKATLVAHGQIGSGQHATDGLVAVRGVLRTPQSGQGYGI
NGAQYGAVSGEITSQDLARAQRLRYQDMYQHPQRALIGTIEATIRAVDEAEDELEAQPQI
DIPKFSDDLSQNRWVDEQMAVNKENVNERLAAMGAATAQVVQWTAVEEYDDRVGTAIATI
GSNLPDVSRNVRDLGYFMEQNDRGDLLEATKRLCGAFGDFLTAVNPEQNERRNKVFTAAG
RVGEYSQHVINTMEPPTDSQQQFDDSLVQKAKHVATSTAQLVLCAKTISAECEEPQVQEK
VIQSATKCAFATSQLVACARVVVPTIDNTACQQQLTTAASKVSHSVHNLLQESELATNRQ
TSLSDIHTAARQVTSALDSLLEHAKTSPKVVSRREEEEEYNEVLKRTNRMIAHQGPSEDL
TREAKKVIRHSQILTEQFQHEAHQRPEHRDRLLDAAKKVAHATSEMILATEQAENQPRQA
ESEWALRSAAERLGQVTNETTQEQQEKHIMQRLEQAAKQTAYDATQTISASNVTKVSVCT
IWVSPRSGAQASDVITHKSYSENLVYESTRTAGLLPSLITSIRESQNALTSGQKFKAQSR
LIRDSHKVLENSVRLFESARTAVPAVNDAHQASSLDQAANRLATSLAELRTAVNDAQQLN
FSQQLIHSEELIKELDEHLVNSHRKAVSRELTPVPTATSFSASSKLMAATSNVGSGVAQL
ITAATSPYDERYIGTSAVELAQGLRDFVDSVVEIVTVRSDIQIDKLIVSARSVVHESGRV
FDRVRERSAPTVLTDTALNVSTSLKQVISCLPDTKHIEKAIIDIQSASTSANIRPMEVRQ
AANQFIESTSQLVATIGSLESKEAVDIFVRAYCNLHCSVIAQLRRQADVNVKTAIVDRLE
QAQRGSIGVLETLRLTGSPSDATLSQQFTLKSQELATIVNQIVELSTADGEEPWQRECDA
ALRRIQAVYHVTQHANVPLNENGYFASLQSVSDDSKRLGEAMTGMARHAKANDTNGFCMS
VRNSADALCHLAESASHSAYLVGISDPSSTPGRAALIDPSEVARSVESINSSCVRIESGQ
LNRDELINNISSIAKQSSSLAQICRNASEKTQNPNVKKHLVSCAMELASKTANLVNAIKV
LDSQRTQEAELRCRESCAELRHVSQQLLHFADKPDFAAIQGSISSEGRSAQTPILQSSRE
MLDASAQMIQTAKSWASAPQDEATWQRMAVNSKQVSDSIMRLVGAIHEAAPGQLELENAI
SRLSALSGQVEKNAMDVYANSNLQHQHGGNAERQLLQQVQHITSQLEDKVDELRSAAVEH
GEHLPKIVRLHCQMVEDLADAACCAAGMTVDSNQQTEIFDKCKTVVEAELAMMVVCRESG
GNPNALHAHNNVNEAASLLKHAIGDMRQTIAKVSSEQGAVQGLVDTISSSIANTDVALSA
HNGASFADSQTRMTAYLEEMRRTAIDMPALGANDLGAASLNLSEKYRLVAGDTRQAVGML
PDADNAQRLKVAVQKLGTSCIDAVTVAGGRRAHPDDERIHRQLTAQSRTVVERAEQVLAA
LHSASRGTQACINAANTVSGIIGDLDTTIMFATSGSLNSSHDQKFPAHRDAILKTAKALV
EDTKALVAGAASNQEQLAVAAQNAVRTIVNLSDAVKNGAVSLTSENSEAQVLIIHAVRDV
AAALTSLIQATKNASGLSLQHQAMGHLKEAAKVMVTNVACLLKTVKSVEDKHHQGTRAVE
AAVEAINFEIRQYDIDASEGAPVPVEVRSEHLQQAADSVAQITQRVVSSADTVQSQEDVI
AVANISRTAVRSLLAIVRSIASEADTAEIRYSVLDTGRDVANNVKTLLVSLHTQMVRNPG
HDESRRLLLEASRGVANSLSKLVGVCTDIAPQSNEEMESAAVQAESELLGAASSIEAASL
RLAELRPRQQTIQNEEAKEEIEFDENILSAAKSITSACQTLMRAASNAQRELAQQGRADH
NRGGVPDYQWSEGLISAARVVVAAVHQLCEAANALMQGQASEEKLISAAKQVASSTAHLL
VACNVKADMDSQAKRRLQAAGQAVKVRANRNITLNAAEKLVQSARQVISRDDRNIVISDR
LVSGIAQVMDAQEEVLRKEKELGEARHKLAHLNKARYEREEGAEI
Download sequence
Identical sequences 281687.CJA15296 CJA15296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]