SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA15513 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA15513
Domain Number 1 Region: 194-618
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.33e-135
Family Reverse transcriptase 0.000018
Further Details:      
 
Domain Number 2 Region: 797-948
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.02e-42
Family Retroviral integrase, catalytic domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA15513   Protein: JA26172   Gene: WBGene00134717
Sequence length 1066
Comment JA26172 WBGene00134717 status:Predicted
Sequence
MKINQKGHAVAFNLHENLITIGDSQIPINFVSEEQPILIFPKEETIIQPQSEAIIPAIIP
DYHIDMGEEFVMEDIKLDAEDCDDIYAVGRGIAQVEPSGTTMIQIFNPSATYVRLKHDQP
IAVASKIGAVKTMEHIDEADWESRLPRLPESVPENFKISSKADLKSACLTEEEKEELRNI
IDYHSSAFVGPDGNLGEYNGNIRHRIDLEEGSKIPQTKIYRIPLEKREEIEKQIKLMLEQ
RIIQPPDSPFLAPIVLVRKADGKSWRFTVDFRGLNAITNPVQSIIPNIQEILDLCGGQEL
YTSLDFQSGFHQILMEPEHSPRTAFACFLGAFEYLRMPMGLKGSPGTFQRCMNLLIKEVK
ARIFIYIDDVIITSKDAKEHLKDIDEVLGKIEGIGMKLKVDKCSFAVNQITFLGFIVSKD
GLKPDPKKTRAVSEFPIPRTVKDVRAFLGTASFYRRFVNNFSKIAAPIIELTKKEEPFVW
TEERQKSFQALKDALTSEPVLVAPRLGKPFIIEVDASGKGVGAVLYQAQDEEGKDLRVVS
YASRVYNAYEKNYPAIELEACGLVFAVKTFRPYIDGARTTIVTDHSPLKSLMYRKELVGR
LSKYQIVLQEFDIEIIYRPGKQNIVCDTLSRYHPEDTNEDKVLPTSKNAEKKRTNKNVTF
TKSPPQINALATNLNIDFERIRKEQLQDENIMELKTKLKKFKVRDDVVFIQTEGKQWIIL
LPQKSPYGKELAKMVHESVFESAHLGIEKTLQRVQTIATWRGMTKAVQKVVEKCVVCQQN
KDSVKLRIKAPLGKFEETTSPFERVHSDYIGPLPETSKKNKYIAMFVDAYSKFIIAEPVT
NQTAEVLCSVFRDRVVARFGTPKLLVTDQGTNFTSQAFRDMLKTMRIEHKMSTPYHHQAN
GQVERANQTVEGMLRQCEDENEWDVDLQTLVHAYNNSSNATTEVTPYVVMHGKEASVEEH
VKNVKSNQEMLQKVCVERIEKKTKKRQEAHDRSINDVEIKVGNKVWIRSPRYNKIGKQFL
GPYEVKEVEEPNVTVLISGPKTRSNKENTRKIHKNRCKVYKESEKE
Download sequence
Identical sequences CJA15513 281687.CJA15513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]