SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA16221 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA16221
Domain Number 1 Region: 228-370
Classification Level Classification E-value
Superfamily PH domain-like 5.84e-36
Family Third domain of FERM 0.00056
Further Details:      
 
Domain Number 2 Region: 124-230
Classification Level Classification E-value
Superfamily Second domain of FERM 1.03e-27
Family Second domain of FERM 0.00011
Further Details:      
 
Domain Number 3 Region: 45-124
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-22
Family First domain of FERM 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA16221   Protein: JA19206   Gene: WBGene00135425
Sequence length 1098
Comment JA19206 WBGene00135425 locus:Cjp-frm-3 status:Predicted
Sequence
MSNIPRGVGAPPPPGMNSSKRGRLVCIKVRMLDDTVAVFHLGVSLVFFDKKTLIICLQHK
AIGQTLLDEVCRHLNLLECDYFGLSFIDANGNHCWLDREKTILRQITHGTTDAKFYFIVK
FYTPNPIDLEEEYTRYLFTMQIKRDLALGELHCSDNTAALLSAYLVQSECGDFSSEDYPD
ATYLSHSRFVPNQSLEFQKKVMDNHRNFIGMTPGESDLAMLEVARRCDFYGVKLHGAKDV
DGNDAALSVMHLGIKVFRQLQLDTTFSWARIRKLSFKRKKLLVKLHPDSYQYLKETVELS
FDTRDECKNFWKKCVEHHAFFRCVQAEEPRKETRFFISKGSSFRYHGRTQKQLIDYVREH
HKRREPFTRPLRSAASTRKGTYSSTYGLVSDRPSKQRNGSVYEPNQADGYNKQNTHSSMP
HIAHISSQPTDHAFSGTLDARVGTSVIRDPPSSSISTTNPRSRQLKRSERCISDVDSVER
PQRSNRPISNAIVVPSNVSKEQPDLSVSLPNVLSDDLQMVCKEIELEQKDPPKSVSGDNF
QERRSSRDYDNVSEDSYRLSDHERSTRSEVGVGSKHAAATIFNSTFVARKPGSNVVKRVV
VHSKSTPNSTDEEEGSALKSVSEYQTFRHIKEYPFVKNANIVPIEIDGPNVDFSARRSPA
ATTVTTRPTATTTTTVTTTSKVLTSSGAVLMRPKVIPNDKEPTSAPHSSRVSPESGTYGA
LGPLPGRVLTKENIVITPEGMKEKKPKPNPPPKPTFPIQAVQAETEVVREVKTERASSHP
LVHLQEEIPFSRAPLKFEEKTERKSSLSRPALISVQSEDNPDVQKCHLFNSDIPYTLTMR
NVESTQSLPYSTFKDLVTAKKQEYESNSLKRVSKSPEFKRRKSLDLVPRKRLPSPGNFSA
QDHTITPSTPDSDVLEYLLRRRSLLGDKTVIKTKNKRTDPRRQTQPVRFDLPPSPCSPTA
GGSTPFISILNDDIFDECVSESRSLHEDMDRLDKTTPHNQSISSFMSQKFRRDSEESDVM
PPPPDEVLNRSISVGKPAPPPPPPKSLAAAVKVAEMKAAAAGKIMYFSENQKDVHTDSPP
FIDDSPKNSSASEATTPP
Download sequence
Identical sequences CJA16221 281687.CJA16221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]