SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA16733 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA16733
Domain Number 1 Region: 361-649
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-73
Family Protein kinases, catalytic subunit 0.000000201
Further Details:      
 
Domain Number 2 Region: 724-873
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 2.09e-35
Family FAT domain of focal adhesion kinase 0.0026
Further Details:      
 
Domain Number 3 Region: 227-331
Classification Level Classification E-value
Superfamily PH domain-like 7.01e-24
Family Third domain of FERM 0.00066
Further Details:      
 
Domain Number 4 Region: 104-226
Classification Level Classification E-value
Superfamily Second domain of FERM 4.13e-18
Family Second domain of FERM 0.0017
Further Details:      
 
Domain Number 5 Region: 7-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000775
Family First domain of FERM 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA16733   Protein: JA32096   Gene: WBGene00135935
Sequence length 877
Comment JA32096 WBGene00135935 locus:Cjp-kin-32 status:Partially_confirmed
Sequence
MEEGLARVFLIGGTSKAVRYDEQTTVERVIHVVARGIGVSQVAVAHFALRLVTGPSPQTA
GSGDSLWLHPMLRIIQLPHIYANHLPIGVCDEIKVEMRMRYMPQSVYELQVTDNAAFIYL
HEQVVDEFFSHVAWRSSVEVALEVAALKVCRDFAEQKQNKYPDHHLEDVDIDACIQSLIP
NVLHNPGLKHSHLKKQFTAYVKKFATTPPNESIIRSLALLLDVVKFDVEVFKASLGAGWT
NPVELVVGPHAGLSYRLNERCDTSRLLELRTIADISIRKMENGSDKTLMQLKLSGVAQAV
LITLSAEELAQSLAHLLDGYQMLYNQRDSVFKLKGIERCETMTMHDATIRPKTPNNENNN
IRLRRELITLKELIGGGQFGNVYKAIYHDLVKGERVAVAVKVCKTDAEPADTQLILQESI
LMRNFRHAHIIQHIGVCLDHPMWLVLELASHGELREYLQQEKEWLPLRTLVLFCAQICDS
LVYLHSTRFVHRDIASRNILVCSPQCVKLADFGLSRALDYDAVYTASRGKLPIKWLAPES
VNYRQFSMASDVWMFGVCMWEIFSLGIKPWAGVKNCDVITHIEQGERPPCPEKCPTALFN
FMRNKLWAIDPHKRPTVDQIYAIIEDIRQQILRNVPFEQIMVGKPMNPAGVIVAEMSSLP
SLTLFRTMEEQKRQAEEDAKWLEQDEEEDDDGVEEEDDDDELKPEHIPSTSHSSVENIRA
SNGYLHHTPTSTRSLRFEDKASQELRRSVDGVCDAVAKLQNSFNNLTHNDEFVLLVKEIT
APLRDLLTIASSMRDRVTTSAQRTECDMTKTLIANDMKQMSRVMAKLQVNGNQAAYNNLR
RDVVRICGELAVNCTTLQLQLTFPPIENEFSTLLSNC
Download sequence
Identical sequences A0A2H2IJT6
281687.CJA16733 CJA16733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]