SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA16784 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA16784
Domain Number 1 Region: 416-538
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000164
Family Pleckstrin-homology domain (PH domain) 0.038
Further Details:      
 
Domain Number 2 Region: 338-385,567-623
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000000977
Family Second domain of FERM 0.0049
Further Details:      
 
Domain Number 3 Region: 626-685
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000197
Family Third domain of FERM 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA16784   Protein: JA32034   Gene: WBGene00135987
Sequence length 687
Comment JA32034 WBGene00135987 locus:Cjp-unc-112 status:Partially_confirmed
Sequence
MAHLVEGTSILDGSWQLPILVTDLNIQRSIYVRGDIHIGGLMLQLVNECDVERDWSDHAL
WWPEKRRWLQHTRSTLDQNGITAETQLEFTPMHKDARIQLPDMQMIDARLDFSVNIVKAT
AKLCRDIGVRHSEELSLKRYVIFNRKDVLNFLIFRYIPPEVLRKGTNDADNYNGPQSIRP
GEESIGPMTLRKAAPIFASQSNLDMRRRGQSPALSSSGHIFNAHEMGTLPRHGTLPRGAS
PSPGAYNDTMRRTPIMPSISFSEGLENEQFDTALVHSPRIAPSRDTPVFRPQNYVEKAAI
NRGWLDSSRSLMEQGIFEGDIVLLRFKYMNFFDLNPKYDPVRINQLYEQAKWSILLDELE
HTEEEATLFAALQLQATLQRDSPEPEDNTKDDVDILLDELEQNLDAAALNRRSDLTQVPE
LADYLKYMKPKKLAAFKGFKRAFFSFRDLYLSYHQSSSDVNSTPIGHFSLKGCEVSPDVS
VNQQKYHIKLLVPTAEGMTDFILKCDSEHQYARWMAACRLASRGKSMADSSYQNEVESIK
NLLRMQSANGNENGTGTSSRKSAAAVKLPNDFNVDEYISSKYVRRARSKQYLQQRVSDAH
GNVRQLTATEAKLQYIRAWQALPEHGVHYFIVRFRNSRKADLIGVAVNRLVKMGVENGES
LKTWRFANMKKWHVNWEIRHLKVGFLG
Download sequence
Identical sequences 281687.CJA16784 CJA16784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]