SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA16836 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA16836
Domain Number 1 Region: 338-706
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.23e-19
Family Reverse transcriptase 0.016
Further Details:      
 
Domain Number 2 Region: 1003-1172
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.85e-18
Family Retroviral integrase, catalytic domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA16836   Protein: JA38001   Gene: WBGene00136040
Sequence length 1316
Comment JA38001 WBGene00136040 status:Predicted
Sequence
MYTRRMHHQPRSTVLFSQSTPTLPSHRSSSQPPHRQRPKRSSTQSFRSRSSNRSASRSEI
QRPKPASAHWTNLGPAKQIFTKRATKALQLIAEVDDFLASPNQAQSVAILQVCHRKLSQF
AANLSQAETEAWQLLDSHPEVSSSPKAKNNNFGILCDHLNARNFKGLRSQMNILLQRIER
KLEQRPIEHFRTSDCVQISHSGMKSNQCGKLPSLDSSNVSEKITKFSVENSNPQKSPSKM
PDSPIMKNERSLSPEPSKARKSANSIEGIKQSENENHSIYQLLKELQHNIDKNNVITSAK
VDGIVKTQHLVFQSIQTMQPSGKTCRRSCNMXXXXSILKSIVGILLRARNKPFLMVADLE
KAFHQVRLQAQHRNATKFLWMKNPHSPPTPENIIIYRFTRLPFGITASPFLLAITIILYM
EMAPEAINDKIAQNLYVDNVLFTPETADEALENYRNSKRAFNNMHMNLREYVCNDSKVMS
IIPETDRASSTTCKLLGLLWDSTNDSLSIKIATPPEGVPTKRQLVAFQAATYDPLGLLSP
IIVPIKLLSSKVCESKVKWKDPIPDKYHQEWIQIKSAFTEKKYTFPRMVTQFKDIEKTSL
IIFSDASKDHYATCAYLVFENKKGEKSSTLIFSKSKIRPINSDNLTIPRMELLGALIATN
AASTLIDELQIPISSVTFFCDNSAVLYWIIHKKPVDKWVSNRIITITATLNKLAEKKLNP
KFRYVPTDLNPADIATRGAILSDLKINSLWQNGPSFLMKNETKWPPSLDDTSADHQEFHC
YILNIQRPAVPRCNSLLTSESPLGYESIVPYHKTNSLRKLVTITNKVLNWTLKTMIKRNA
RFQDRPYIWQNQTMQKYAMANITKNETQKRALTLQYIIKDHYVDSEYRMDIKPPISEHIH
KDKNGVYHYENSYVNKKNVNLPKSLIYIMHKHPLARLIAADSHESLLHQGPKDMASDIQQ
RYWIKRITTLTRSIRKNCLICKRQHGKPYKYPFATALPAIRTHACRPFQHVGLDYFGPIG
YKTSSGNNGKLWAMLTTCLVTRAVHLEIVPDNSTSRFLLGMRRLIGRRGAPKSIISDNAP
AFSLGYAMINADIQSMINSSQTLTSYLASKEIEVRQITPFAPWQGGVYERIVAIVKNMFF
KTIGNNQFSYIEVESLLIECEGIINSRPITTNPISISDTEAIRPIDFMLPLAELSLPNGV
ITANNTNSSITERQTRKYLESLNATRQKLWDEFYNELYTGKKAPTYKNRAHNSEVPKIGL
VVLVETPLVPRYRWPLGRITELIKSSDGKTRSVTIKCKNKLIQRAVNQLIPLELTQ
Download sequence
Identical sequences CJA16836 281687.CJA16836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]