SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA16875 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA16875
Domain Number 1 Region: 608-745
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.67e-27
Family Retroviral integrase, catalytic domain 0.017
Further Details:      
 
Domain Number 2 Region: 438-470
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000174
Family Retrovirus zinc finger-like domains 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA16875   Protein: JA29573   Gene: WBGene00136080
Sequence length 900
Comment JA29573 WBGene00136080 status:Predicted
Sequence
MTSTTKFVIENELEDGNGQDGGQYNEFIDDAILDEDMDIDNVGKDHEVKKREDEARLKTL
EEYTIFDDNHVNDQVTAQTAAQPPVDATSANNTLLQTEVPSAVVKDIQDFMEANGITRIA
TSEENKLRRRLLDLQSQNTELRLKIDIKESEMAAIRKHCGQVEAKLNVDPLKKEGEQRRV
VSRDLYFIQDTGDRLPCRPTPEGLHKTRASRGEYFERIENPREYQREMDVILDERTNRGN
TKESVCYRQKNRPAQTELSLLSQLYLEQNLPEPPKYTAEKDSVSIGAFEKTFAMKFGRLS
AEQQVTLLETKYLQVEDETRRAKTRWESLRIAENQSVEDFCLLLDEVARIAYRRLPPEEL
SSLKTAKLLGAIAGNEALRCMIDAKLLEYPEKEHYDICRLLAVRHEMSLNESREKREVRS
ERDGKMVTLDRKVRNFSNVLPNSQSFPKVAVQCFKCGVYGHTARVCPTLAEAPVQRNALK
EPNLKVESIDIKGLDVQQRKRVKVLGMKGEVPVDHYALIGKSLRNTEIEGTCRFVVPKRA
RAALLQEAHEGVLAGHFGTEKMVRQLSRRFFWPNMRASIQSCVKACAKCLCTNDAPKLVA
PLTPYGTTYPLEVVACDLIDVGLSVQGNRYILTILELFTKNGTAVPIPDKTRRIPHTLLT
DQGKEFDNGMFQQFTRMLKICHEMTKGYNSRANGAVERFNKTLMHIVKKKTAVIMEWDDQ
VVFAVYAYNNVAHTTTGETPTYLMHIFSCRCSRPCVFYPPSATTAPTTSPSLLLAMMNLL
ELKPELAHKPSELLLLAQANLPFEMNIPSHEALLAMAHCPTLQLMCREEPAWNIAFTHTF
SALMRKFFGEDFTSQPVNTLLVLAPGVRESTVTLAFTKKLVLKSAESAEDLLLEQLNRKR
Download sequence
Identical sequences 281687.CJA16875 CJA16875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]