SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA16885 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA16885
Domain Number 1 Region: 1-356
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.34e-120
Family Reverse transcriptase 0.0000373
Further Details:      
 
Domain Number 2 Region: 540-701
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.97e-36
Family Retroviral integrase, catalytic domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA16885   Protein: JA37855   Gene: WBGene00136090
Sequence length 1010
Comment JA37855 WBGene00136090 status:Predicted
Sequence
MCIDYRKVNKVVKNNAHPLPHIEATLQSLSGKKIFTTLDLLAGYWQIPLKEASKQITAFA
IGSELFEWNVLPFGLVTSPAIFQATMEAIVGDLLGKNVFVYVDDLLIASETLEQHVEDLR
TILTRIKNSGMMLRASKCHIAQREVEYLGHKITPEGVQTEEKKVERMRKFSRPTNAKELH
SFLGLVGYYRNFIMNFSKIAAPLTPLTSPKTAWKWEEEQEMAFQQLINKICEAPVLIQPD
VEAALNGDKPFLIYTDASKQGIGAVLAQEGKDGKQHPIAFSSKSLSPAEKRYHITDLEAL
AMMSALRRFKTIIYGTPVVVFTDHKPLMYLLKGTPLADRLLRWSIEILEFNVKIVYLKGK
ANEVADALSRGGCSPVESEDTETTELNMIVNEIRGEKSDDVLDNSNWFEWLKEEDEGWNE
IIDKLENGEEKCRVKVLGMKGEVPVDHYALIGKSLRNTEIEGTCRFVVPKRARAALLQEA
HEGVLAGHFGTEKMVRQLSRRFFWPKMRASIQSCVKACAKCLCTNDAPKLVAPLTPYDTT
YPLEVVACDLIDVGLSVQGNRYILTILDLFTKYGTAVPIPDKTSETVLKAFNERWALGEG
RIPHTLLTDQGKEFDNGMFQQFTRMLKIRHEMTKGYNSRANGAVERFNKTLMHIVKKKTA
VAMEWDDQVVFAVYAYNNVAHTTTGETPTYLMYGRDSRGPLEMDGEDAVGINYADMDEYK
HLLTHELLKTQKIVKEHAMGEHEKYKRLFDEKHRTATRKYPEPGSRVLVEIPAEKLGAKC
PKLINKWKGPFRVLECSNNSATLTPVLGKGKDVICVPFDHLRVVPDEMGDEEIKTKKGRA
KKKVAHLEGDFCDEVSMRDPNETFFRHIFSCRCSRPCVFYPPSATTARTTSPSQLVAMMN
LLELKPELAQKPTELLLLAQANLPFEVDIPSQEALLAMAHCPTLQLMCREEPAWNVAFTH
TFSALMRKFFGEDFTSQPVNTLLVLAPGVRESTVTLAFTEKLGSEERGVS
Download sequence
Identical sequences 281687.CJA16885 CJA16885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]