SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA16949 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA16949
Domain Number 1 Region: 21-346
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 7.56e-93
Family Reverse transcriptase 0.00081
Further Details:      
 
Domain Number 2 Region: 526-681
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.54e-41
Family Retroviral integrase, catalytic domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA16949   Protein: JA35890   Gene: WBGene00136155
Sequence length 919
Comment JA35890 WBGene00136155 status:Predicted
Sequence
MVTQELNRLVKQGVYTATDYSDFHPLPTAKDIFSTLNGGKYFTQIDLSEAYLQIEVDEDS
KKMLTINTHLGLFYPNRLPYGVKSAPAIFQQIVDTMISGIGRIEEHNRRLQSLFERIKEY
GLRVKSSKCSFLQSEVKFLGFIVNRNGRRPDPAKITAIEKMPAPTDVSQLRSFLGLVQFY
GSFVKDLHNFRGPLDELTKKDVDFVWTKSCESSFGRIKDVLKSDLLLTHFDPKLPIIVAA
DASNYGIGAVITHRMADGSEKAIFHASKSLTAAQRGYSQIEKEGLGLIFAVEKFHRYLHG
RKFTLRTDHKPLLAIFGSKKGIPVYSSNRLQRWALIFLNYDFDIEYINTASFGQADALSR
LIATNLANVESEDRVIASVEADLDAEHRGIINNLPVNATTILKASKADPTITAVIKYVRD
GNWPKLEKTSPVYQFFNRRESLSIINDTLMFGHRIVIPKSLRSRVLQTLHQAHPGTDRMK
KLARSFVYWPNIDKDIENLVRNCVDCQAAAKNPVKTTLEPWPASSSPFERVHIDYAGPIN
GIYYLVVVDSFSKWPEILPTKSITATATIALLIPIFARFGNPKTLVSDNGTQFTASEFAT
FCASRGIRHLRSPPFHPQSNGQAERFVDTLKRALQKMRREGTTQEALQKFLMSYRSTPCS
SAPNELSPAENFIGRKMNTIMDLMLPATHGSRLDRDQSMDKMKEQFNRHHGAKKKEFSPG
DAVFVKDYRSKVTWIPGHVVARFGKVKYRVECNGQLWDRHANQLRRRDHQISTSSPLLEM
FDLPSQTSHSNPPPICSPHLPLQHLPQFSPHRQALSNSSPARRLSSNVDRQSKPMDSLSS
IDLPSQQMDLSSSDALSLDDAAMDGSSSDGSTMTRAGPCAPVVSSSSQGLAGPLPLRRSE
RAPKIPSRLNMASSGKSYK
Download sequence
Identical sequences 281687.CJA16949 CJA16949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]