SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA16953 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA16953
Domain Number 1 Region: 322-753
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.45e-21
Family Reverse transcriptase 0.018
Further Details:      
 
Domain Number 2 Region: 1044-1211
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.72e-20
Family Retroviral integrase, catalytic domain 0.018
Further Details:      
 
Weak hits

Sequence:  CJA16953
Domain Number - Region: 72-107
Classification Level Classification E-value
Superfamily Acid proteases 0.0021
Family Retroviral protease (retropepsin) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA16953   Protein: JA32395   Gene: WBGene00136160
Sequence length 1833
Comment JA32395 WBGene00136160 status:Predicted
Sequence
MEKKDKQKPTQGRTMAASINSECNRESQDSNEEDAQTKTPTAATSPSGGRTTSIPTVQAE
AYNPDTSTWESISLMIDTGADLTFISEKIAKNWKLPIIKKDKFTLTTFKSGEPRSEEYAL
TKVKFRVPNSNKDLEITPYISNELVGRIKKRVLPPDDMMHLLKHNIQMNKDAFETSVIPD
MIIGDDFVTLILTGKMVFLPSGMALLDTVFGNTTIGRSRSSPIETDQDGHYMFTVMRETG
IDEAQRVEEQQKRDTAMKKPEEYTGSLADEKAALERATVEHFKATVEKRGKSFYVRLHFK
DDREELPDNYSIAVKRLVVIGRQYSRAVLKIIDDVFRDQIEKGILEIVDIFELTGNRLVH
YNPHQPVFTPTKTTTKCRVVVDGSAHYKNKPSLNDQIHQGPTILPDLVGMLLRFRSGGIA
VISDAEKAFLQVYLHEDDRDVTRLLWVKDIDKDFSGDNIMVVRFTRVLFGLNVSPFLLAA
TINHHLETIDDQDMAHEMSNNLYVDNLLMTTDSDPESAFRLYSYPKETFTDMGMNLRVFT
TNSKELRKRIPIEDLSEETTPKVLGIPWDIDEDQLIMEVKLDDCKSNSRRTVSSVIHGIF
DPLGNMAALILPMKLFQRELWLDEYDWDTPLNAAHEAQWQQLVEDIQGFSKRIPRHVISK
SLTNKLLTFTDASKEATAWTIYIVNDMGCHLIYAKSKVKPLKEVWTIPKLEMQALEMGTV
NTLKTMQYLQIGNINITESHIFTDSTIALSWVKGATDKKVVGILVANRLKSIYNTVDQIT
DLGIPVRFGHVASEDNPADLGTRGCNKDLTDNTLWFNGPIPTGQSLEQWVQEHDTFTLDT
EVHHAYGMISTGQDQVTVFDCTVTNDFVKMIQIVAFTMKFLKKRLATGKDTLRKKIPGWT
EFTDLATISTEEFRKAREILIKDQQKLITPQEIKSWNDLGLTKDDRGIMVSVGRMENAEL
ENEAKFPILLQPNSALAKMIILYEHGKLHLSENHTITAIRAKYCLPKIRQQVKKIIAKCV
PCQRVSKLPYKYPDMAPLPAMRVTKTRPFEHIGIDGFGPIEYKGLDGEVHKAYGIIYVCM
VTRATHIEVVTDQRASSFLQSLRRFIGIRGMPTKILTDNGTNFTLGAKIVKEALDASDLP
EEVRHFLRIRDIEWKFITPLSPWKGGMYERMVKIAKQAFMKERRLQKLNLEELQTVFHEV
AAMMNDRPLTYPDNEIGTLNPIRPSDFLTPKLPVTFPLEATLPSLDDYLPSKKAQAVETR
KGTIKMLEASIDASEKIWKRFSTEYLTELRTHHKSRMDKKRGSASQPRVGQCVLLWEEQP
TPRNVWKIGQIKELVTKTDGTTREALVKTVTGNELRKSINHLIPLELDEPEDDETPKSPE
PESPIVAEDNQEKRYNLRKRKTTNYAEDTDNDVYFANSSHSMITSTIPITLVMLICLVGN
AFGKEIQGINPATTTTPYCSSHGIHISGYFEAFEACVEDYCTNYHQLKWNNMNNEYDVWI
PQDKKIRPHHSTIKIFDGKKMKTWELDCQAVPFCDTIDCTICWTNVLNPECHIWWAILGL
AATVFISLLIIHSVCFTPIKLVATFILGWRFTQFVWLCTSTLIMAIWKRCKCNWRGTTRR
RFNRMRTIVLLFAVMMTSLTQGCQQVDVYTQFQKVCSQENERQCEVFTEVAMDLSSTHRE
GCTRLEKNGTVLRDIRIRLLDIQQECTKETITYTQEVQTRVWSSKRCPSMGSCTGGKCKD
VNRTTLLPELSNSNQFVGNTYCTESCGAIGCGCGWFSSACMFYRIYAFPTSSEEVEVFQC
LDYQPTARLQITSSKLNTKDNKIWDKEVVVPIX
Download sequence
Identical sequences CJA16953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]