SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA17254 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CJA17254
Domain Number - Region: 18-67
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0867
Family DNA polymerase I 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA17254   Protein: JA29342   Gene: WBGene00136456
Sequence length 170
Comment JA29342 WBGene00136456 status:Predicted
Sequence
MLEAVNDWTESIDESAQVDVIYLDYAKAFDRVPHDILLGKLVDANLNPNLIKWIRSYLSN
RTFCCGRRVSIFTTMNNQHNEHVSDTSIYGKKRKKEADVTSSTWLGTKKGEAFGSATFRN
VTFRNCDDSQLTHSTPGINTVFRTTRVTMTSDVPHDIALVEAATATELSR
Download sequence
Identical sequences 281687.CJA17254 CJA17254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]