SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA17578 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CJA17578
Domain Number - Region: 2-29
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000314
Family Second domain of FERM 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA17578   Protein: JA12632   Gene: WBGene00136782
Sequence length 37
Comment JA12632 WBGene00136782 status:Predicted
Sequence
MQRCRELRGQTASEAEILFLDHCKHLAVYGIHLFKAI
Download sequence
Identical sequences 281687.CJA17578 CJA17578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]