SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CJA17977 from Caenorhabditis japonica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CJA17977
Domain Number 1 Region: 52-114
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000000406
Family Second domain of FERM 0.001
Further Details:      
 
Domain Number 2 Region: 21-56
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000393
Family First domain of FERM 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CJA17977   Protein: JA37178   Gene: WBGene00137182
Sequence length 178
Comment JA37178 WBGene00137182 status:Predicted
Sequence
MQPEQRTRRPTTPSTTRHVIYDKEEGIRHWLYNDKKILKQLKNLPWEFSFEVKFYPTTPT
TIVDDHARYYVFIQLRRDILTGRLPATADTHALLGSFVAQIEFGDAPAQVNDEYENFIVG
ARLVPTEHSNAEVSQTERTDGFGGGDFVPGPLATVNLQEDEGPRHREKKSRPLRRTLT
Download sequence
Identical sequences 281687.CJA17977 CJA17977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]